21 B2B Customer Retention Statistics That Matter 2026

You’ve probably been searching for the latest statistics on B2B customer retention, and you’re in luck! We’ve gathered the most relevant data on this topic from all over the web.

But why? Why would you want to know about B2B customer retention? Because it’s essential for your business. A strong customer retention strategy is critical to success, especially in today’s competitive market. When you’re able to effectively retain your customers and turn them into repeat buyers, you’ll be able to build a customer base that will be loyal to you for years.

Whether you’re a marketer or a business owner, we can all agree that finding relevant data is no easy task. We know how frustrating it can be to spend hours searching for the right information—especially when there’s so much of it out there! That’s why we created this list: to save you time and energy by gathering all the best info into one place so that you can make more informed decisions about your business.

This list of statistics will give you everything you need to know about B2B customer retention, so make sure to bookmark this page and come back whenever you need a quick refresher or just want something new and exciting!

General B2B Customer Retention Statistics

1. Typical B2B customer retention rates range between 76% and 81%

(Forrester)

For B2B companies, the average retention rate is usually quite high. This is because B2B brands invest more time and effort into developing long-term relationships with buyers.

According to Forrester studies, the average B2B customer retention rate stands between 76% and 81%. However, the report also notes this number can differ drastically between industries.

Forrester also highlights that to increase customer retention, decision-makers need to gain broader insights into their businesses. 40% of decision-makers are already implementing centralized tools for building reports on revenue opportunities.

2. Customer acquisition costs for B2B brands have increased 60% in 5 years

(Profit Well)

A study by Profit Well into the rising cost of acquiring new customers over retained clients suggests “customer acquisition cost” is increasing. According to data taken from around 700 subscription companies in 2019, CAC costs for both B2B and B2C brands increased by approximately 60% within a period of 5 years.

Notably, the report also found that B2C acquisition costs are slightly higher than B2B prices. Yet, the cost per acquisition can vary depending on a company’s position in an industry. B2B brands with more experience in their market have seen an average increase of 70% for CAC.

3. Only 48% of B2B companies focus on customer retention, compared to 82% focused on customer acquisition

(Act-On Software)

A study conducted by Act-On software and Gleanster research examined customer relationship management strategies for 750 mid-sized firms. The report found around 82% of these companies had strategies in place for lead generation and retention, but only 48% were investing heavily in customer retention strategies.

The study also found only around half of the companies (51%) were taking advantage of customer loyalty strategies for up-sell revenue. Additionally, only 43% of companies said they were investing in customer satisfaction campaigns.

4. Around 50% of B2B companies stay with the same vendor for 5 years

(B2B International)

B2B International regularly conducts surveys into its client base to learn more about their purchasing habits. One common question asked by the company is, “how many brands or suppliers have you replaced within the last five years.”

According to the organization’s findings, between 40-50% of B2B companies do not introduce any new suppliers or B2B services within a period of five years. This indicates many of the top B2B brands can retain their customers for at least five years or more.

5. Referred B2B customers have a 37% higher retention rate than acquired clients

(Think Impact)

A report conducted by Think Impact on the power of B2B referral programs found that 83% of customers are open to referring a business after a positive experience.

What’s more, 78% of B2B referrals create viable leads for the business. Most importantly, referred customers for B2B companies have a 37% higher retention rate than consumers acquired in other ways.

These customers also have an 18% higher chance of becoming long-term clients compared to clients who were not referred. Despite this, the report also found only around 3 in 10 B2B companies have a formalized referral system in place.

6. 71% of B2B customers are “psychologically and emotionally” detached from their suppliers

(Gallup)

According to Gallup’s Guide to the Customer Centricity trend for B2B business leaders, over 7 out of 10 of all business customers are already emotionally and psychologically detached from their existing suppliers. They also define themselves as being ready to take their business elsewhere and willing to look for other suppliers.

The Gallup survey also found one in five customers for B2B brands have experienced issues with products or services and often run into problems when trying to solve the problem. Only 40% say the problem they had with a brand was ever resolved.

A tiny 5% of the respondents for the study said their experiences with B2B sellers was “highly satisfactory.”

7. 71% of high-grown B2B brands have a clearly-defined strategy for customer experience

(Forrester)

According to Forrester, the majority of high-growth brands in the B2B space are successful because they have a clear end-to-end strategy for customer experience, which includes guidelines for improving retention and satisfaction rates.

71% of the high-growth B2B businesses in the study said they had a comprehensive vision of customer experience in place and a roadmap for CX.

How Retention Influences B2B Success

8. The average B2B company generates up to 30% of its revenue from retained customers

(Act-On)

Exploring the benefits of customer service on sales revenue, software company Act-On found that the average B2B company obtains around 30% of its total revenue from its existing customers. However, the same report also found only around 18% of any company’s time is committed to finding ways of retaining B2B clients.

9. 65% of B2B companies can successfully upsell to retained customers

(ThinkJar)

Research by ThinkJar CEO Esteban Kolsky found there are significant benefits to a successful B2B customer retention strategy.

According to his insights, around 91% of unhappy customers say they’d stop buying from a company entirely without stopping to make a complaint. He also discovered attracting new clients to replace lost customers was 6/7 times more expensive than retention.

Kolsky also found that 65% of businesses can easily cross-sell or up-sell when they’re appealing to existing customers. Alternatively, only around 12% of companies are successful in increasing average order value when interacting with new clients.

10. 80% of a B2B customer purchasing decision is based on buyer experiences

(Sirius Decisions)

According to a report from Sirius Decisions, companies in the B2B landscape can’t hope to retain customers based on features and pricing alone. The report discovered up to 80% of all B2B buying decisions are based on a purchaser’s direct or indirect buyer experience.

Unfortunately, less than half of all B2B customers feel their providers offer them the necessary post-sale support they need, leading to rapid churn and turnover. Only around half of the respondents in the study said they plan to buy again from their current B2B providers.

11. High-performing B2B brands are twice as likely to invest in retention and experience strategies

(Econsultancy)

A report by Econsultancy into the evolving B2B buying experience found that the most effective B2B brands are investing more heavily in customer experience to improve brand loyalty, retention, and profitability.

High-performing brands in the study were twice as likely to invest in experienced-based buying activities built to improve retention.

12. Investing in customer experience reduces churn by 10-15% for B2B companies

(McKinsey)

Research from McKinsey into the benefits of B2B retention strategies found that investing in customer experience and satisfaction scores significantly improves retention. According to the report, improving customer satisfaction scores can reduce customer churn by 10-15% for B2B brands.

What’s more, investing in customer experience also helps to improve the win rate of sales pitches by between 20 and 40% and lowers costs per acquisition by around 50%.

13. 51% of B2B companies avoid vendors after a poor customer service

(Zendesk)

A report by Zendesk found B2B customer service and retention rates often go hand in hand.

According to the study, 51% of B2B companies deliberately avoid and stop buying from businesses after one bad customer service experience.

The report also revealed that 62% of B2B buyers purchased more products from the same brand going forward after a good customer experience, while 66% of companies stopped purchasing from companies entirely based on the experience they offered.

B2B Retention and Brand Loyalty Statistics

14. 57% of B2B loyalty programs have been running for less than 2 years

(Comarch)

While loyalty programs are commonly associated with B2C companies in most industries, they’re growing more popular with B2B brands too.

According to Comarch, as of 2022, around 57% of B2B loyalty programs have been in place for less than 2 years. However, the report also found that B2B loyalty programs are up to twice as likely as B2C programs to run for over 2 years.

For B2B companies investing in loyalty programs, the biggest challenges have been a lower than expected adoption of the program (17%) and an inability to integrate the solution with existing tools.

15. 39% of B2B brands offer cashback as a retention strategy

(Comarch)

In Comarch’s study of B2B loyalty programs, the company found that B2B organizations are most likely to use types of cashback as a retention bonus. Around 39% of respondents said they offer cashback redeemable specifically with their brand as a loyalty bonus, while 32% offer general cashback.

When it comes to future plans for loyalty programs, 19% of B2B brands say they plan on including early access offers in future. Another 16% said they’re planning on adding subscription-based loyalty bonuses, and 14% are looking into the benefits of gamification for loyalty.

16. SaaS companies average around a 3-5% monthly B2B customer churn

(BareMetrics)

Churn rate in a B2B business refers to the number of customers a company naturally loses over time. These are the clients who aren’t preserved by the company’s efforts for customer retention. The average churn rate can vary for each brand, depending on industry and customer base.

For SaaS businesses focusing specifically on smaller companies as customers, BareMetrics notes the average churn rate is around 3-5% per month. However, early-stage SaaS companies can often have a churn rate of up to 15% for the years when they’re still developing.

17. 75% of business buyers are now influenced by ethics

(Salesforce)

According to Salesforce’s report looking at buyer behaviors in the post-pandemic landscape, business buyer retention rates are now more dependent on a company’s ethics and values. 75% of business buyers said they make decisions on whether to purchase or continue purchasing from a company based on their ethics.

61% of consumers in the report also said they have stopped purchasing from a company whose values didn’t align with their own. A further 59% said they have switched brands based on the ethics or values displayed by a company.

B2B Retention and Customer Experience Statistics

18. 85% of B2B buyers value customer experience as much as the features of a product

(Salesforce)

According to Salesforce research from 2020, approximately 85% of business buyers consider the experience they get from a brand to be just as important as their services or product features when it comes to ensuring retention. A further 53% of these customers also say they feel a strong emotional connection with the brands they buy from most.

84% of business buyers in the report also said they’re more likely to trust and stick with a company that understands their business goals and expectations. However, 57% of business buyers say sales reps generally have less than adequate knowledge of their business.

19. 91% of B2B buyers say a positive service experience makes them more likely to make another purchase in future

(Salesforce)

Salesforce’s report on the “State of the Connected Customer” found customer experience is the most important factor in ensuring customer retention. 91% of respondents in the survey said a positive customer experience means they’re more likely to make another purchase in the future.

The report also found that 78% of respondents said they would forgive a company for making a mistake if they offered amazing service. Furthermore, 71% said they have made purchase decisions explicitly based on customer service standards.

20. Lack of speed in interactions reduces B2B retention rates

(McKinsey)

According to a McKinsey survey looking at 1000 decision-makers from the B2B landscape, speed was a critical factor in determining retention. Retention levels for B2B brands were twice as likely to drop when the speed of interactions was low compared to when prices were high.

The demand for more speed in B2B interactions has also led to around 86% of respondents saying they usually prefer to avoid sales reps entirely and use self-service solutions instead.

21. 42% of B2B companies invest in customer experience to improve retention

(Genesys)

As customer experience and retention become more connected in the B2B landscape, Genesys found approximately 42% of B2B brands are investing in experience specifically to enhance customer retention.

Customer retention was characterized as the number one reason to invest in CX, followed by improving customer satisfaction (33%) and increasing opportunities for upselling and cross-selling strategies.

Conclusion

We hope you’ve found this list of B2B customer retention stats useful. We know that the search for relevant, up-to-date stats is never easy, but we’ve made it a little easier for you by compiling all of these into one place.

So now that you’ve gone through the list of statistics, what can you do with it?

Identify key areas in which your business is lacking and focus your efforts there
Understand the reasons why customers are leaving your business and implement strategies to retain them
Make sure that you’re following industry standards when it comes to customer retention
Ensure that your employees have the tools and knowledge they need to best serve customers by communicating clearly and effectively. (You’ll be surprised by how much this will improve their performance!)

We want to remind you that there’s no magic bullet when it comes to improving your customer retention rate—it takes time and effort from everyone involved, from the CEO down to the newest hire on the team. But if there’s one thing we’ve learned from our experience with other companies just like yours, it’s this: you can do it!

So keep an eye on those retention rates, and remember: as long as they’re going up instead of down, you’re doing something right!

39 SEO Spending Statistics To Boost Your Business

20 Bounce Rate Statistics You Need to Know Right Now

27 Personalized Marketing Statistics To Keep You Ahead

17 Customer Acquisition Statistics You Need to Know

Sources

How Does Rakuten Make Money? Business Model of Rakuten

Rakuten is a shopping rewards company that gives consumers cash back when they shop at popular retailers. The company has a creative business model.

Rakuten primarily makes money from affiliate commissions paid by their retail partners. Rakuten also makes money from commissions on in-store purchases and by selling data to advertisers.

Rakuten.com was launched in 1997. It is a part of Rakuten Group, a publicly traded e-commerce and financial technology company headquartered in Japan. The Rakuten Group was founded by Hiroshi Mikitani.

While Rakuten.com used to run an eCommerce store at that same domain, The Rakuten Group closed that store in 2020. Currently, Rakuten only operates a shopping rewards service on that domain name. This service is something the Rakuten Group began offering after their 2014 acquisition of the online rebate site Ebates.com.^{^[1]}

The name Rakuten translates from Japanese to mean ‘optimism.’

What is Rakuten & How Does It Work?

Rakuten is a shopping rewards company that offers consumers cash back rewards when they make purchases on eCommerce sites. They offer Apple and Android apps and browser extensions for Chrome, Firefox, Safari, and Microsoft Edge.

Consumers download their app, install a browser extension, or visit Rakuten’s website. They can then browse through Rakuten’s 3,500 retail partners that offer cash back rewards via Rakuten when users shop at their online stores. Rakuten’s retail partners include many large consumer goods companies like Old Navy and Sephora and department stores like Walmart, Target, and Nordstrom.

When a customer clicks on an affiliate link on Rakuten’s site or app, they are then sent to a retail partner’s website where they shop and make a purchase as they normally would. Once they make a purchase, Rakuten receives an affiliate commission for referring the customer to the retailer. Then Rakuten passes a portion of the affiliate reward on to the customer. That can work out to anywhere between 1% and 40% cash back.

When customers use the Rakuten browser extension, they don’t even have to click on a link from Rakuten. They just navigate to the site they want to purchase from, and Rakuten automatically notifies them if there are any coupon codes available on that website.

That’s particularly helpful for customers since it can be hard to remember all 3,500 of Rakuten’s retail partners. Customers can also link their credit card to their Rakuten account so that they can get cashback in-store at participating retailers.

Rakuten helps over 17 million people earn cash back on their purchases. In total, Rakuten has paid out over $3.7 billion in cashback rewards across over 3 billion shopping trips.^{^[2]}

Membership is free, and Rakuten often offers rewards for new members to sign up and make their first purchase. This usually includes a $10 welcome bonus after they make a purchase of at least $25.

The site also often offers additional cashback on days like Black Friday and Cyber Monday. In addition, they offer pages where customers can find hot deals or stores offering double cashback deals.

Customers get paid once a quarter. The money Is sent to them either via check or PayPal transfer. While the US site is Rakuten’s main site, Rakuten also runs cashback sites in other markets, including Canada, Japan, and France.

Business Model of Rakuten

Rakuten.com’s business model is based on affiliate commissions that it passes onto its members. Many online retailers offer an affiliate commission when other websites register for their affiliate program and then send customers to their site. Rakuten is just taking advantage of this on a much larger scale.

With Rakuten, customers typically use a link or input a code that has Rakuten.com’s affiliate link in it. The retailer then credits Rakuten with whatever percentage of the sale they promised to pass along via their affiliate program. The amount that they pay will depend on the agreement Rakuten negotiated with them.

This is a common way website monetize their content. However, Rakuten does this on a much larger scale. Rather than use affiliate commissions to monetize a blog or media site, Rakuten’s business model focuses on creating a repository of affiliate links that customers can click on. They get their customers to do so by offering them a portion of the affiliate commission.

This makes sense for consumers since they are able to shop at major retailers and get a discount just for being a Rakuten member. Meanwhile, Rakuten is able to make a significant amount in affiliate commissions by earning commissions at scale.

While they pass along a portion of their commissions to customers, they still make a considerable amount of revenue on the portion of the affiliate commissions they keep.

The benefit of using Rakuten to purchase things for a customer over another company with a similar business model is that they have done considerable work to create partnerships with a large number of businesses. Having 3,500 partners makes it easy for them to attract new users.

They also offer the ability for customers to link their credit cards to Rakuten and get cashback rewards for in-store shopping. That’s something many other rewards sites don’t offer.

Companies benefit from partnering with Rakuten by having customers who are more likely to buy from their sites than their competitors since they’re able to get a discount on their purchases through Rakuten. Rakuten also offers them access to user data in order to engage Rakuten shoppers better with personalized offers.

Rakuten has a number of competitors. These include coupon sites like retailmenot.com and Swagbucks.

While it is unclear how much Rakuten makes off of Rakuten.com since the parent company doesn’t separate its revenue streams, it is likely that Rakuten.com is very profitable. The site likely doesn’t have significant expenses since they don’t have to maintain inventory or employ a large workforce. Their main expenses are development costs, staffing, and advertising.

How Does Rakuten Make Money?

Rakuten makes money in three different ways. These are affiliate commissions, commissions on in-store purchases, and the sale of customer data.

Rakuten.com is part of a much larger public company that doesn’t explicitly list how much they make from Rakuten.com. Data on how much they make from different revenue streams is, therefore, also not available.

Affiliate Commissions

Rakuten makes the majority of their income from affiliate commissions. However, there are a few different kinds of affiliate commissions they might generate by referring their customers to an online retailer.

Pay-Per-Sale Affiliate Commissions

These commissions are paid when a Rakuten customer navigates to a partner site and buys something. Rakuten then gets a portion of the total cost of the sale.

Pay-Per-Lead Affiliate Commissions

These commissions are paid when a Rakuten customer navigates to a partner site and fills out a contact form or an application for a service. Once the company verifies the lead, Rakuten gets a fee for referring the lead to them.

Pay-Per-Click Affiliate Commissions

These commissions are paid when a Rakuten customer navigates to a partner site. It doesn’t matter what the customer does once there, Rakuten is paid solely for sending customers to a partner’s site.

How much Rakuten makes from a partner varies considerably. For example, partners that sell very high-value items might pay a higher commission because it is harder to acquire a lead. Whereas popular retailers might pay a much lower commission since they have lower profit margins. Some partners also potentially pay more than one type of affiliate commission to Rakuten.

In-Store Shopping Commissions

Rakuten offers customers cash back or discounts on in-store purchases. Customers simply use the credit card or bank account they’ve associated with Rakuten at the store to make a purchase, and that purchase gets credited to their account with the promised cash back.

Rakuten.com earns a commission for every qualifying purchase. It is unclear how much the company makes on these purchases.

Data Monetization

One part of Rakuten’s business model is monetizing the data that they gather from their 17 million customers. The company aggregates and anonymizes this data and then sells it to marketing companies and other data brokers who then use it for market research, to design ad campaigns, or in other applications.

The data sold is of users’ transactions and purchases. Rakuten does not sell user personal data. It is unclear how much the company makes on these sales.

Rakuten Funding, Valuation & Revenue

Rakuten.com is owned by Rakuten Group (TYO:4755), a publicly traded Japanese company. The Rakuten Group is traded on the Tokyo Stock Exchange. The company’s stock sold for 695 Yen in August 2022. That price values the company at $1.1 trillion.

Aside from Rakuten.com, Rakuten Group owns a number of different subsidiaries, including the messaging app Viber, the e-book distributor Kobo, and Rakuten Mobile, a mobile carrier in Japan. They also have a banking unit.

The cashback rewards service run on Rakuten.com was previously called Ebates.com. Rakuten Group bought the company for $1 billion in 2014.^{^[3]} This Rakuten Group subsidiary is likely worth much more now. Prior to being bought by Rakuten Group, Ebates.com raised $25 million in three funding rounds from one investor, Founders Circle Capital.^{^[4]}

While there isn’t publicly available data on how much Rakuten.com makes, Rakuten Group releases annual reports as a public company. They have been investing in growth in recent years and generating significant losses. In 2021, the company brought in $1.68 trillion Yen in revenue but lost $135 billion Yen. The previous year, the company brought in $1.45 trillion Yen in revenue and lost $115 billion Yen.^{^[5]}

Year	Total Revenue	Net Income/Loss
2018	$1.1 trillion Yen	$141 billion Yen
2019	$1.26 trillion Yen	($33 billion Yen)
2020	$1.45 trillion Yen	($115 billion Yen)
2021	$1.68 trillion Yen	($135 billion Yen)

Is Rakuten Profitable?

Rakuten.com is likely profitable. While the cashback reward site’s parent company, Rakuten Group, does not release details on how much their subsidiaries make, Rakuten.com has a streamlined business model and consistent revenue stream.

That said, Rakuten.com’s parent company is currently not profitable. The Rakuten Group has seen losses in the tens and hundreds of billions of yen in 2019, 2020, and 2021.^{^[6]}

Conclusion

Rakuten is a huge company, with operations in many countries and a variety of different businesses. But despite its size and complexity, the business model is pretty simple.

It works by selling ads to retailers and then giving customers who buy from those retailers a percentage of their purchase back as cash or points. This gives people an incentive to shop with Rakuten’s partner retailers rather than directly with them. It also means that every time someone shops with one of these partners, they are generating revenue for Rakuten without having to pay any fees themselves.

Rakuten has proven itself as an innovator in the field of e-commerce, and it shows no signs of slowing down. As more people turn to online shopping, Rakuten will continue its mission of providing customers with the best possible shopping experience.

Well, that’s all for today! It’s been a pleasure to walk you through this article, and we hope you found it informative.

If you have any questions about how Rakuten makes money or if there’s anything else you’d like to know about their business practices, please don’t hesitate to reach out.

Thanks again for reading!

How Does Honey Make Money? Business Model of Honey

545 Shopping Slogans and Taglines To Help Sell Anything

Sources

859 Spring Captions To Brighten Your Instagram Feed

Are you looking for spring captions to add to your Instagram photos? Well, your search is over! In this article, we’ve put together hundreds of catchy, sweet, and funny captions to help you get in the Spring spirit. From cute captions to beautiful and poetic ones, we’ve got you covered. So whether you’re spending your Easter weekend outside or just enjoying the sight of flowers blooming in your garden, these captions will add an extra bit of spring joy to your photos!

Spring is finally here, and that means it’s time to break out the cute spring clothes and enjoy the warmer weather! Spring is the season of new beginnings and clean slates for many people. Everything in nature starts to rejuvenate itself and shows signs of new life. It’s viewed as a time for a change, getting your life together, and starting something fresh.

It’s also a great time to post some cute photos on social media of you having some fun in the sun. But don’t forget some nice spring-themed captions to pair your photos with. We know that finding the right caption can be a daunting task, but we are confident that the captions below will help you capture the beauty and spirit of the Spring season in an unforgettable way.

So, without any further ado, let’s begin!

Cute Spring Captions for Instagram

Spring is finally here, and that means warmer weather, blooming flowers, and lots of photo opportunities!

If you’re looking for some spring captions to help show off your colorful Instagram photos, we’ve got you covered. From cute phrases to simple expressions of joy, these captions will help you capture the beauty of the season.

Spring is here, and I’m so glad.
Spring, you are a miracle.
Springtime is here, and everything is right!
Can’t get enough of springtime!
The prettiest season of the year: Spring!
Everything is going to be great this spring!
The sweet smell of spring in the air.
Spring has sprung, and so have I.
Keep calm and welcome spring.
May your days be bright and breezy!
Spring sunshine on my mind.
Feeling hopeful and excited for Spring!
The colors of spring are in the air!
Happy spring and all that comes with it!
Fresh new beginnings, happy spring!
Capturing the new spring vibe!
Just enjoying the beauty of Springtime!
Nothing is so beautiful as spring.
Cheers to sunnier days and longer nights.
Life is just starting to become really special.
Fresh air, fresh blooms, fresh start.
Spring fever has struck.
New beginnings, brighter days.
This spring, let life’s colors flow.
Ushering in the new Spring warmth!
Enjoying the simple beauty of springtime.
Meet me under the cherry blossoms.
Spring is a time for new beginnings and fresh starts; a time to begin anew.
It’s time to welcome in the warmth of the sun, and revel in its glow.
Springtime is a wonderful time to reflect on all of the good things in life.
When it’s warm outside and the flowers are blooming, there’s just no feeling like it!
Everything is changing, and life is just getting better and more beautiful!
The flowers are in bloom, and the temperatures are rising! Spring has finally arrived!
The sun is shining, and I feel like singing.
I’m ready for all of the happy memories that come with springtime!
Can’t wait for all the new growth and change in springtime – it’s going to be amazing!
Cherishing every moment of Spring – even when it’s a little cold!
Gone with the winter.
The return of the sunshine! #springtime #happyhearth.
Springtime feeling is a warm embrace that makes me feel so good inside.
Seeing all those tulips in the park is making me really excited for spring!
Spring is such a wonderful season – I can’t wait for it to keep going.
During springtime, every flower becomes a work of art.
The colors are so bright and vibrant in springtime – it’s such a beautiful time of year!
The warmer weather means fun in the sun! #springtime.
Seeing all these beautiful flowers in bloom makes me happy just looking at them!
Happy SPRING everybody! At last, the weather is getting better!
Mother Nature is a crazy lady, and she’s always showing off this time of year.
Bursting into color! #springtime #fun #vibes.
Spring is a time to let go of the past and embrace the future!
Wanderlust is alive and well – can’t wait to explore all of spring’s hidden treasures!
A light breeze, warming temperatures, and budding plants…perfection!
Can’t get enough sweet snippets of springtime goodness?
Springtime isn’t complete without a little bit of peace and serenity.
Springtime celebrations are always a lot of fun!
Loving life in the great outdoors during springtime!
Bring on the sunshine!
Take a deep breath, sit back, and enjoy the simple pleasures of spring! Life is worth living!!
The weather can be really unpredictable during spring, but that just makes it more interesting!
Sunny skies and flowers = beautiful spring photos!
Finding yourself in all different places – this is what Spring is all about, sister!
The crisp air, the flowers blooming, the grass growing green.
Let’s dance around the sun while basking in all of the spring sunshine!
Spring is the perfect time to take a walk in nature and enjoy the sights and smells of all the new growth.
New life coming out of the ground, flowers blooming, water droplets dancing in the breeze…life is so gentle and perfect!
Seeing all of the new growth makes my heart happy!
Spring is such a beautiful season – all of the flowers are in bloom!
Waking up to sunshine, birds singing, and budding trees… pretty much everything feels better in springtime!
Spring is a time for new beginnings, unbridled optimism, and love in all its forms!
Soaking up all the lovely spring scenery before it’s gone.
The birds are starting to twitter, and the flowers are opening up!
I’m looking forward to all the spring festivities!
A spring day is perfect for a little sunshine, fresh flowers, and of course, good friends.
Springtime in the city is so charming!
Fresh flowers are the best way to celebrate spring’s arrival.
The days are getting longer, the flowers are blooming, and springtime is finally here!
Opening up the curtains to see this spring sunrise 😍
Better weather is coming!
The best part of spring? All the new outdoor activities that come with it! From hiking to biking to picnicking… there’s no limit to what we can do!
Flowers are starting to come into bloom, trees are budding with new leaves, and the sky is bluer than ever!
Blue skies, bright sun – can’t ask for more, right?
Everything is new and exciting in springtime!
Spring has sprung, and so has our mood!
Finally, nature is starting to awaken again 😍
Marking the end of winter and the beginning of spring – happiness is in the air!
Spring is a time of new beginnings, and with that comes lots of new possibilities.
Whoaa look at that colorful sky- it’s almost like spring brought sunshine to every cloud!
Spring is a time of hope, rebirth, and change. It’s a time to start fresh and start over again!
Spring is such a happy time – it makes me want to start planning my summer vacation already!
Fresh flowers in every vase, basking in the sun – that’s spring for me!
God’s green earth providing us with the freshest fruits and veggies yet again 🍊🥔
Let the freshness begin!
Drenched in sunlight and happiness 🌲
New leaves, fresh flowers. The warm breeze, the sweet smell. Oh, how I love you, spring!
The flowers are blooming, the birds are singing, and the temperatures are finally starting to warm up!
Springtime is when I start fresh with my wardrobe, taking advantage of all of the new colors that come out!
Springtime is the perfect time to love life more and enjoy all of the free things nature has to offer!
Daisy days ahead.
Ready for a change in weather?? Spring is on its way!
Springtime is a time to enjoy the sunshine and fresh flowers.
The best news of the day? Spring has finally arrived!
Spring is a time for rebirth and renewal, and every leaf, blade of grass, and blossom brings something new into existence!
Time to start cleaning out those closets and find some new spring clothes!
This spring, let’s all try to live a little more simply and love more freely! Life is too short to be stressin’!
Such a lovely day for photo shooting! #springtime.
Play, dance, and enjoy every minute of spring!
The flowers in Spring bloom for a reason.
Life’s a beautiful cycle, always keep moving forwards!
The days are getting longer, the weather is starting to warm up, and flowers are starting to grow!
Spring is finally here, and that means it’s time for color and excitement!
Springtime means reuniting with old and making new.
No more gloomy days now that the sun is out and spring has sprung.
Spring has sprung – let’s get out there and enjoy all of nature’s beauty!
Take a deep breath and enjoy the natural light this springtime!
Isn’t it amazing how even the smallest things can make us feel so happy?
#TheresNoStyle like the spring style!
Even though it’s still cold outside, there’s a certain energy in the air that tells you spring is coming!
Flowers, birds, sunshine… what can be better than that?
Springtime is a chance to start fresh with all new possibilities!
It’s officially springtime… which means we can finally start wearing brighter colors again!
Bloom in your own way, color outside the lines, create your own path, and love every step of the journey.
So excited for spring! The trees are budding, the birds are singing, and everyone’s moods seem brighter.
Got some new home accessories waiting for me that I can’t wait to use this spring!!
Spring fever has sprung – can’t stop looking at all those pretty flowers!!!
Spring breeze, flowers blooming, and warm weather ahead!
Springtime means new beginnings! Revel in them!
Flowers blooming, birds singing, and an invigorating breeze – it feels like spring just arrived!
It feels like just yesterday that winter was winding down – but now it’s time for spring to start! Let’s get excited about all of the sunshine and warmer temperatures coming our way!
The colors of springtime are like a rainbow for your eyes.
Springtime is a time to appreciate life.
Springtime is a time for taking pictures and celebrating every little detail – it’s so beautiful!
Splendid spring weather!
Can’t wait to see the wildflowers bloom this year!
Time to break out the skirts, dresses, and sandals – it’s springtime!
Springtime is a perfect opportunity to start fresh and let go of past mistakes and burdens.
Springtime is a beautiful reminder that change happens gradually but surely in life.
Some days are just meant for long walks and naps.
Springtime is a time to get outside and enjoy the fresh air.
The weather is so nice, let’s enjoy all the sunshine we can get!
Stretching out in nature to recharge during this beautiful day ♥️☀️☀️
If there’s one thing spring is testimony to, it’s the power of renewal.
Spring is finally here! And with it comes beautiful sunshine and landscapes.
Spring is a perfect time to let go of winter stress.
One of the best things about Spring is how every day feels like a new adventure!
Springtime is a time for love and happiness, and nothing says “I love you” like a picture of our favorite flowers growing together.
Springtime always makes me feel optimistic and excited about all of the upcoming possibilities!
In joy or sadness, flowers are our constant friends.
Happiness is like a warm spring day.
Spring fever has hit me hard! Time to get active!
In the spring, every day feels like a radiant miracle!
Life just got a bit brighter – can’t wait to see what the future has in store!
Springtime means warmer weather, friends, and happy memories – nothing could be better!
It’s spring, and daffodils are blooming!
#Springtime means lots of changes, but we love it all.
Can’t get enough of these sunny days in spring!
The warmth of the sun on your skin, the sweet fragrance of flowers, and soft breezes – this is what Spring feels like to me!
Spring is the time of year when things start to come alive!
Soaking up the sun on a bright spring day – couldn’t be happier!
April showers bring May flowers!
Happy spring everyone!! Time for new beginnings and new dreams!!
So happy Spring has finally arrived!
I love all of the new shoots of flora popping up everywhere!
Oh, spring! You’re so lovely and fresh and new!
Springtime means flowers and gardens, love and happiness!
Seeing the new spring bloomers everywhere!
Can’t wait to get outside and enjoy all that this season has to offer!
I can’t think of anything more wonderful than being in the forest in the spring.
When spring rolls around, so does my mood!
Grey skies? Not on my radar! #springtime.
Celebrating another beautiful spring day together as a family!
Love is in the air! And flowers are everywhere!
Tender shoots of new growth – can’t wait to see what Spring has in store!
Flowers in bloom gives me happy thoughts 🙂
A broken heart heals in spring.
A little sunshine, a little rain, and everything starts blooming again.
Nature never looked so pretty – why wait? Get out there and enjoy the bounty of spring!
Sunny mornings + cheerful sunsets = so much happiness during Springtime :).
Bright and beautiful days ahead! #springfling.
Springtime is a time for dreaming big dreams and making plans for the future.
Flowers just seem to blossom a little bit more in springtime.
Greens are emerging from their winter sleep, trees start budding – it’s official: Spring has sprung!
A day spent lounging by the pool on a warm spring day.
Enjoy the blossoms, nature is so amazing this time of year! 😍
Warm weather and cheerful people- it doesn’t get much better than that!
#SpringBreakLife is my favorite life of all.
A perfect spring day… sun, smiling faces, and lilacs!
The sunlight during spring is just so radiant and gorgeous!
Those sunbeams shining through the trees are just too perfect to ignore!
Sunrise during spring is one of the most beautiful things on earth – just look at those amazing colors!
Spring is a time to clean up your life and make it new again.
Spring is a true reawakening of nature’s beauty all around us.
In spring, all of our thoughts turn to future dreams – hopeful for a brighter future ahead!
You can never be too happy when it’s Spring!
The sun is shining, and the birds are singing. It’s time for springtime adventures!
The sharp smell of rain in the air…the sound of laughter in the trees… it’s spring! Sweet, sweet spring!
Fluffy bunny ears, sunny skies and all of the flowers in bloom… life can’t get better than this!
What a beautiful day for a spontaneous picnic! #springtime.
Seeing all these new flowers motivates me to start planning my garden soon 😊
The fresh green leaves and blossoms of spring are a sign of renewal.
Blue skies and new flowers – what’s not to love?
Spring is a time to be hopeful for the future.
Spring is a time to clean up our homes and organize everything so that everything will be ready for summer!
With each flush of spring, love blooms anew.
When spring came, even the false spring, there were no problems except where to be happiest.
Every flower is a soul blossoming in nature.
Spring is nature’s way of saying let’s party!
Spring is a time to write happy memoirs with sparkling champagne in hand!
Life passes by too fast sometimes. I love relishing every single moment that nature has to offer during seasons like spring!
Can’t wait to start spending more time outdoors in nature, surrounded by all the pretty flowers!
Spring brings with it wonderful dreams and adventures!
Spring is good for you! Nature got it right.
#Spring brings with it wonderful dreams and adventures!
Spring is a time to get our gardens growing again and celebrate all of the fresh produce that we will be able to enjoy throughout the summer months!
Spring is a time to celebrate change–whether it’s the change of the season or our own personal changes!
Springtime weather is perfect for cuddling with your loved ones!
The day the Lord created hope was probably the same day he created Spring.
Feeling alive and happy in nature right now! 🌺😍
The flowers in my garden are starting to bloom!
Spring shows what God can do with a drab and dirty world.
A spring day wouldn’t be complete without a sunny sunset!
A spring morning full of hope and possibility.
This spring, let your beauty shine through!
Spring, my dear, is by far my favorite season. I love how everything comes back to life after an entire winter of being dead.
Girls just wanna have sun.
So happy to be alive in this moment! #SpringtimeMagic.
Another beautiful day in the springtime!!!
Giddy up! Spring is in the air!
I can’t wait for all of the bright colors in spring!
Wildflowers don’t care where they grow.
#Everyday feels like a bonus in Spring!
Spring cleaning? Check. Clean laundry? Check. New whitespace in my apartment? Check! 😊
Hello, spring please be good to me.
As spring dawns, possibilities seem endless!
Swimming in our pool after a long winter… Heavenly bliss!
Too excited for Spring to not document every single step!
New beginnings, new thoughts…let Spring bring everything beautiful!
We’re finally out of winter and into springtime adventures!
The best way to start the day is with a spring sunrise.
Showers bring out the best in flowers! 😍☃️
Dancing around like nobody’s watching! #springtime.
Go ahead and embrace all of nature’s goodness while you still can!
The first signs of spring are appearing!
Springtime is a time for renewal! Clean up your act and start anew with fresh motivation!
You can cut all the flowers, but you cannot keep spring from coming.
Lovin’ every minute of spring flowers blooming + everything sunny & bright!
Ahh, spring – the time of year when everything is fresh and new again.
Sitting in front of a cozy fire with a good book in early Spring ❤️❤️❤️
What does spring bring? Welcoming breezes, revived joy, and beautiful flowers!
Spring is definitely the season of love and new beginnings!
Spring is a beautiful time to reflect on all of the good things that have happened during the winter months.
Capturing moments like this make everything worth it.
The weather is finally changing, and it’s time for all things spring!
Gone are the cold winters, hello Spring thunderstorms, and blooming plants!
Spring is a great time to set goals and jump on opportunities that come your way!
Spring cleaning? We don’t need that! Just let the flowers take over our homes this spring!
Loving every moment of spring with friends and family!
The snow is gone, the flowers are blooming, and the sun is shining – it could not be a better time to be alive!
Springtime brings happiness and cheerful thoughts – which is the perfect environment for good photos.
The earth is waking up from its long winter sleep, and spring is the perfect time to show it some love!
The days are getting longer…and brighter!
Bright spring flowers, warmer temperatures, and happy people = the start of a great season!
Woke up to these sun-drenched beauties 😍🌞
Spring is a time to get excited about all of the new possibilities waiting for us in the future! 8.
Celebrating another year of life with fresh flowers, trees, and Spring weather!
In love with life during the most beautiful time of year: Spring.
Come spring, everything comes alive–from the trees to the flowers!
A spring day – what else could you ask for?
The prettiest time of year = springtime!!!
Just living is not enough… one must have sunshine, freedom, and flowers.
I love everything about spring, from the cheerful colors to the warm weather!
Nothing beats a sunny day in spring!
In bloom, happy, and ready to love life 🍀
Can’t wait to see all the beautiful things that come during springtime.
A new season means a new wardrobe and possibilities!
Flower power all day everyday.
Floral prints + bright colours = Spring in my heart!
Look at the bright side of Spring!
As the days grow longer and the temperature starts to rise, so does our spirit!
Apricot blossoms in bloom – it’s officially springtime!
It’s officially time to break out the shorts and tank tops!
Splendid sunshine on a beautiful day!
It’s such a treat to wake up to spring sunshine every morning!
Goodbye to old winter clothes. Hello to pretty spring wear.
Love planted a rose, and the world turned sweet.
No matter how long the winter, spring is sure to follow.
Spring weather can make us all feel like kids again – let’s go outside and play!
The colors of springtime are breathtaking!
Celebrating a special occasion on a nice spring day? Absolutely perfect!
A spring morning spent outside with nature is always a joy!
Blossoming trees and wildflowers = springtime at its best!
It’s finally sunny outside! Time to take advantage of it :).
Springtime brings us hope, new possibilities, and fresh starts! So excited for all the new adventures life has to offer!
Flowers in bloom = spring sighting!!
Springtime means lots of changes, but we love it all.
Springtime in the city – so vibrant!
Springtime is definitely my favorite time of year! The weather is always perfect, the flowers are in bloom, and all you can do is bask in the sun!
Strolling through nature’s prettiest scenery.
It’s all sunny days from here on out now that it’s spring.
Spring, Spring, the best season of all.
I’m starting to feel a little like the spring season.
Standing under a blooming cherry blossom tree with your friends…pure blissful happiness.
Happily tumbling in the spring sunshine!
Swinging through the trees and feeling free ^_^.
Sunny days in the springtime just make me happy!
The days are getting warmer…and more beautiful! 🌴.
The colors of Spring are in the air and they’re so bright!
Summer days can’t compare to the beauty of spring!
Walking through nature brings me so much joy! Spring is such a special time.
Spring reminds us that everything is possible and that we have so much to look forward to!
I’m so glad to be alive, because I think I met the perfect springtime.
Look at spring legalizing in the blink of an eye!
Bloom where you are planted! And be proud of all the hard work that has gone into making this season perfect.
Spring means rebirth – let’s each take advantage of this wonderful season!
Sunshine, laughter, and hopes for the upcoming season… it’s a good one so far!
Springtime is a time to start fresh and be inspired by all the new growth around you.
The sun is shining, and the flowers are in bloom! Here’s to a great spring!
Walking outside in springtime – the smell of flowers, sun, and trees is so intoxicating!
Springtime… it’s time for love, laughter, and long walks on the beach!
It’s springtime, and that means we can finally start taking pictures of the beautiful flowers and landscapes!
Swimming in a crystal clear river on a lovely spring day!
Wandering around in nature is one of my favorite things to do in springtime!
Feeling so happy and excited for spring!
It’s so nice to wake up to a beautiful day like this!
The sun is out, the sky is blue, and everything feels brand new!
The beauty of nature can never be overstated – nothing compares to the vibrancy and freshness of springtime!
A fresh start for a new season, #springtime!
Even though winter may be coming to an end, life still has so much to offer us in the form of springtime!
When flowers bloom, who cares about the thorns?
Time to come out of hibernation and start exploring all that spring has to offer!
Spring fever is like a love affair. It takes over your mind and keeps you from focusing on anything else.
Sometimes all you need is a little sunshine and flowers to make everything feel right in the world.
The world looks so different when you see it through innocent eyes!
The world is a beautiful place, and spring is its most splendid season!
Feeling optimistic about life right now? Yeah, me too! Springtime always makes me feel this way.
Living life just a little bit richer each day – that’s what Spring feels like to me!
Spring is a time of renewal and comes with lots of exciting things to look forward to.
Bursting with color in the Spring season! 🌿🌷🎭👨
Throwing a backyard party with friends! #springtime.
Flowers are blooming, bees buzzing, and birds singing – it’s springtime!
Springtime means planting things, blooming things, and most importantly: making lots of friends!
Spring unlocks the flowers to paint the laughing soil.
It’s always such a joy to wake up in spring and feel the positive energy flooding through my veins!
I’m ready for some sunshine!☀️
Spring is the perfect time to kick off a new season of life!
It’s a beautiful day, don’t let it get away.
The days are getting longer and warmer, yay!
Time to let go of the winter blues and get ready for all the fun things spring has in store!
A spring day just wouldn’t be complete without a few butterflies flying around 🙂
Isn’t spring the prettiest season? The cherry blossoms popping up in our parks and gardens are so captivating!
Springtime is a season of rebirth – it’s a chance to start fresh and be more optimistic.
In spring, with every breath, I’m grateful for the journey ahead.
Happiness fills me up when I see these happy spring scenes!
Flowers bloom in the springtime, and we can’t help but be drawn to their beauty.
Everyday feels like a bonus in spring!
Everything seems possible now that winter has ended.
May your days be as bright as these daffodils 🌼
I can’t wait to drench myself in some sunshine this spring!
Spring is sooner recognized by plants than by men.
Dancing in the smell of flowers.
Springtime reminds us to start living more spontaneously and enjoy the moment instead of planning everything ahead.
Woke up to these sun-drenched beauties.
Spring has sprung, and so has my love for life 😊
Spring may be a time of change, but at least it means we can finally break out of our winter clothes!
Feeling grateful for spring as it slowly starts to creep into summer!
Come outside & celebrate the new spring season!
Springtime can really rejuvenate your spirits!
Flowers in bloom, birds singing…life is just starting to feel a little more wholesome.
Spring has a way of making us feel really optimistic.
So excited for spring! The colors are so vibrant, and seems like life is just getting started!
Heading out on a sunny day to explore… natures wonders await ;)☀️
Spring brings hope and change, both in the weather and in our hearts.
Spring is a time of rebirth, new beginnings, and natural beauty.
What a beautiful day! Can’t wait to see more of spring.
Loving all the pretty pastel colors during springtime!
It’s officially springtime – get ready for some sunshine, fun memories, and delicious treats!
Spring is a season of optimism, hope, and new beginnings!
Spring is a time of new beginnings, and with that comes a burst of new energy.
Walking in the springtime is like experiencing a new life.
There’s something special about springtime…it just makes everything feel possible!
Birdies, bunnies, and blossoms = everything is so pretty during spring time!
A natural light photo session in the park: perfect.
Spring has sprung, and life is good!
Soaking up those vitamin D rays ☀️.
A beautiful day in the spring – all around us are signs of rebirth!
All of our doubts and fears vanish during springtime – we’re reborn anew!
A colorful sunrise over the horizon – what a beautiful start to spring!
Another spring day: red tulips, blue sky, and butterflies!
After a long winter, it feels amazing to finally see some flowers and plants popping up everywhere!
Spring is a time to jump into love and adventure with all of your heart!
The flowers are blooming and the trees are starting to bud! What a beautiful sight!
Ready or not, here comes Spring!!! ☀️🌷🌼
Spring is finally here!! Can’t wait to enjoy all of the perks.
The best time for new beginnings is now.
🌥 🌨 💐 🌸 🌼 ☀️ ☔️ 💧
Bumping into springtime happiness everywhere we go.
This view just makes me happy ❤.
The best part about spring is all of the optimism it brings us!
It might be cold out, but at least the flowers are starting to bloom.
Spring is a time of rebirth – new beginnings, fresh starts, and optimism!
Seeing the world from a different perspective is one of the best things about springtime!
Flowers always make people better, happier, and more helpful; they are sunshine, food, and medicine for the soul.
Flowers, birds, and butterflies…#springtime #naturallife #sunnydays.
What a perfect day to spend outside with friends and family! ☀️☀️☀️.
Watching your little one joyously play outside in the freshly colored grass…pure bliss 🙂.
The best way to start the day is with a natural, spring sunrise.
The prettiest flowers are only going to grow in abundance this spring!
Fragrant fields, juicy fruit, and happy animals–Spring season is a paradise.
Spring is a time to bring new life into the world.
This amazing spring season has been so full of change and growth!!!
Showering under a blossom-strewn sky – couldn’t ask for more in Springtime!
It’s such a beautiful day out! Spring is finally here!
What’s spring? It’s the sun shining on your face. It’s new life and new possibilities.
Loving every bit of Springtime – it’s so bright and cheerful!
Stargazing on a cool spring night.
Spring has sprung – cue the twee songs and happy thoughts!
Springtime always has such an enthusiastic atmosphere – it’s energetically uplifting!
Just when winter is over…spring comes roaring in style!
The world is such a beautiful place in springtime!
Running through fields of wildflowers is the best way to start off spring!
Leaning on nature for comfort on this beautiful spring day.
Life is too short to waste another minute in a gloomy winter mood!
Can’t wait to start wearing more colorful clothes and enjoying the gentle breezes outside!
My favorite season is Spring because everything comes alive!
Springtime is a time to get excited for all that’s ahead!
Sunrise and sunsets are so beautiful in the springtime!
The gorgeous colors of springtime in nature.
Spring is a time of rebirth and new life, and it smells sweet!
A little bird told me. Spring is coming.
A shy songbird coming out of its hiding place – such a sign of spring!
I’m absolutely loving every minute of Spring!
Cherish every moment during these blossoming days #GoldenDays.
Ooooh the sweet smell of spring in the air! Sniff…sniff…
Whispers in the wind – spring is a time when life starts to awaken and whisper to us in the wind. Listen closely.
A beautiful day to take pics! Happy spring everyone! 🌲🌸
Dandelions and daisy’s deciding to make a comeback this year! #springtimefreshness.
This spring, let’s start fresh and banish all of our winter blues!
Taking walks through nature always makes me feel better.
Planting seeds of happiness.
Springtime is a time to let go of what no longer serves us and to start fresh–it’s a time to grow and learn!
In spring the best blood rises to the brain, and now my thoughts are bright and clear.
Spring is a time to start over again and be reborn.
The sun is shining, the flowers are blooming, and the birds are chirping – it’s officially spring!
Taking a walk in nature always puts a smile on our faces during springtime! Even better when we get to meet some new friends along the way.
Starting off the week with some spring vibes.
April showers bring May flowers 🌷.
Finally breaking out of that winter funk!
Time floats like a butterfly during spring – it just keeps moving forward! Can’t keep still for long!

First Day of Spring Captions

Spring is in the air! The flowers are blooming, the birds are singing, and the sun is shining. The best way to celebrate the first day of Spring is by spending time outside.

Whether you’re taking a walk in the park or soaking up some sun at the beach, make sure to snap some pictures and use one of these captions to share your memories. Happy first day of Spring, everyone!

The first signs of spring. Brightly colored flowers popping up everywhere!
It’s the first day of spring, and I can’t wait to take a swing!
Springtime cannot come soon enough!
Spring is here at last, and it’s time to celebrate.
The sun is shining bright, and the flowers are blooming right.
Spring has officially sprung!
The first signs of spring make me so happy.
Happiness is the first day of spring.
The first signs of Spring are starting to show up!
The first day of spring finally arrived, and we couldn’t be more excited!!
Out of winter, into spring. Out of darkness, into light.
The first blooms of spring always make my heart sing.
Spring is my favorite time of year because it’s the first time everything starts to grow again.
Spring is always beautiful and inviting.
Oh, hello spring! It’s been a while since we’ve talked.
Don’t be fooled by the rain, Spring is here!
Welcoming spring with a smile.
Spring is here, and it’s just in time.
Spring, oh spring! I love the way you smell, and the way you make me feel.
It’s time for fresh starts and new beginnings, but also time to relax.
Spring is here, and that means flowers, flowers, and more flowers!
At last, everything’s starting to come together again after months of icy cold temperatures! 😊
Happy spring! Time to get out of the cold and into the sun!
Glitter on the grass, flowers in the sky. Spring is here!
Spring is here at last, and I can’t wait to take a walk!
Spring, you’re such a happy season, and I love your warm embrace.
It’s still a little chilly out there, but spring is here!
Spring has finally sprung, and we’re all feeling the rush.
Spring is here! Can you feel it?
Spring is here, so let’s have some fun!
The warm weather finally arrived & I’m so grateful!
Spring is here! This is the best time of year.
With the arrival of spring, all of our hopes and dreams come true.
Spring is here, and I couldn’t be happier—or more allergic.
The flowers in the garden are starting to bloom, signaling the arrival of spring!
Bright colors + happy people = perfection! ❤️ #springtimevibes.
Bright and cheerful flowers in every color – spring has finally arrived!
Spring arrives to spoil us rotten with its lovely blooms and cheerful vibes!
Days slowly become longer, flowers start to bloom, and warmer weather arrives……life just feels better in general during springtime!
When you see all the greenery budding in the garden, you know that spring has finally arrived!
Finally, a day without any snow – spring has finally arrived!
Watching kids play in the park – so happy to see spring arriving early this year!
Springtime means flowers, sunlight, and happiness!
The first blossom is always the most beautiful.
The first day of spring is one thing, and the first spring day is another.
A spring morning, waking up to the first blush of color.

Funny Spring Captions

Spring is finally here and in full force. The weather is getting nicer, the birds are chirping, and the flowers are blooming. What a great time of year! To celebrate, we’ve put together a list of funny spring captions.

Whether you’re taking photos of the outdoors or just enjoying the nice weather, these captions will add some extra hilarity to your snaps. From puns to one-liners, there’s something for everyone. So go ahead and enjoy these light-hearted laughs.

Spring is finally here! I can’t wait to wear my new spring clothes and smell the flowers.
Spring cleaning is so much better when you do it with someone you love..
Happy Spring everyone! Let’s enjoy this beautiful weather while it lasts..
This morning, I woke up to tulips everywhere and I couldn’t be happier!.
I love waking up in the morning and seeing all the new blooms in my garden..
The warmer weather means that it’s time to chill out in our porches with a good book or some outdoor activities..
It’s officially springtime – time to get dressed up, stay outside all day long, and have lots of fun!.
Nature is definitely testing our patience this year.
Isn’t it amazing how a spring storm can turn into such a beautiful thing?
The flowers are blooming, the birds are singing… and it’s time to get your spring cleaning on.
I love spring because it means I don’t have to wear a coat for two months straight!
It’s finally spring! Time to get outside and bask in nature’s beauty.
I’m just trying to get my spring on, guys.
Spring is the time when everyone wants to be outside, but then they have to go inside again.
Why do we have spring? Why not just have one season where it’s all sunny?
Let’s get this spring started with a bang!
Spring is here, and I’m all like… WOOO!
I got my flower crown, and I’m ready to PARTY!
Spring cleaning is so much more fun when you’ve got a good mood to start with.
It’s time to get all these old leaves out of my hair!
Spring: like fall, but with more rain.
The birds are singing, and I’m wearing socks!
Spring will be here soon enough to make you want to punch your boss in the face.
Spring is here! And so are the allergies.
There’s just something about the freshness of spring that makes us happy.
Can’t wait for summer to arrive so we can start wearing shorts again!
April showers may leave you wet, but they will also leave you with a spring tan.
The snow is melting, the flowers are blooming, and the sun is shining – cue the spring fever!
Another year, another chance to break out those old skirts!
Daylight savings time is finally over, thank goodness! Now let’s all go back to sleeping until noon.
It’s officially springtime – time to dust off those gardening gloves and get to work!
Spring is here! And that means…
Let’s all celebrate spring fling by getting ridiculously drunk!
Time to dust off those old jeans, it’s going to be a hot one this year!
It’s officially springtime! Time to start planting those peas in the backyard and joyfully singing “I’m Just a Little Turtle Short of a Happy Home” all day long.
Spring showers bring out the best in everyone, including the daffodils.
Finally, summer is on the horizon – which means barbecues, baseball games, and spending lazy weekends lounging on the porch reading books while wearing maxi dresses!
Spring is in the air–literally!
All of nature’s colors are coming out in full bloom this month.
It’s officially springtime, which means it’s time to bust out the tulips!
Spring always brings spring cleaning with it!
Finally, some decent weather! Time to get out and play!
Can’t wait to venture out into the world again – sans jackets and socks!
Spring cleaning gone wild: everything in sight is getting tossed out!
Spring cleaning routine: one room at a time.
Finally the weather is starting to feel like spring!
It’s officially spring break and that means cotton candy galore! (or as my mom likes to call it, sugar junkies paradise!).
Bright green fields, warm sun, and happy flowers.
How beautiful is this spring sunrise?!
Winter has had its day, so spring it is!
Isn’t Spring the prettiest time of year?
Can’t get enough of sunny days and dainty flowers!
The birds are chirping, the flowers are blooming, and it’s time to get WILD in the springtime!
Springtime is a time to plant new seeds and see what grows.
Boy do I feel lucky to be alive in this glorious spring season!
Here we are, just another day in the life of a typical spring-loving person!
Finally, blue skies and sunshine everyday! What more could one want.
The birds are singing, the flowers are blooming and life is just getting better and better!
Spring cleaning is over and I’m so happy I can finally put away all my winter clothes!
Spring fever has officially set in; can’t wait to break out the sandals and skirts!

Short Spring Captions

The weather is warming up; bright colors are popping up wherever you look, and that means it’s time to get outside and enjoy the springtime. Whether you’re taking a walk in the park, having a picnic, or just sitting in the sun, here are some short spring captions to help you capture the beauty of Spring.

Bright and early spring!
Finally, springtime!
A springtime awakening!
Joyful springtime colors.
A lovely spring morning!
Spring is here!
In love with spring!
Hello, sunshine!
So glad it’s springtime!
Spring is finally here!
How lovely is springtime?
Bright and beautiful spring.
It’s spring, y’all!
Dreams come true in Springtime!
Flower power forever.
Finally, it’s springtime!
Spring into action!
Blossoming flowers in the park.
The earth laughs in flowers.
I’m so egg-cited for spring.
All the flowers, no allergies.
Starting off spring with a bang!
☀️☀️☀️ Energetic days ahead!
Joyful greenery in the springtime.
Now that’s fresh.
There is no spring without flowers.
Spring is my favorite color.
Stop and smell the roses.
Bloom wherever you go!
Flourishing in the springtime!
Spring is my happy place!
Spring brings out the colors in me!
Secretly in love with spring.
Another day, another spring! 🌺
Getting ready for springtime fun.
Springbreak fun!
Ah! The sweet scent of spring!
In spring, everything feels possible.
So excited for all the new colors!
The glow of Spring!
So wonderful to see spring arrive!
This spring, let the sunshine in!
Stirring up some sunshine this spring!
A sunny day in spring is perfect!
I can’t believe it’s already spring!
Bright and cheerful tulips, so pretty!
A new season of growth and change.
All hail the arrival of spring!

Spring Captions for Couples

Spring is a time of renewal, when nature blooms and blossoms, bringing a feeling of love and joy to the world around us. You’re probably also excited about all the fun spring activities coming up. From picnics in the park to Easter egg hunts, there’s plenty to enjoy this season. And what better way to celebrate than with your significant other?

Whether you’re taking a romantic stroll in the park or simply enjoying the warm weather together, use these romantic spring captions when you share that lovely couple selfie on Instagram. These will let your loved one know how much you care.

Just some sweet photos of us together during springtime!
Passing along some love during springtime.
Spring is beautiful and full of life, just like you!
You put the spring in my step and the blossom in my cheeks.
Roses are red, violets are blue, it’s springtime, and I’m over you.
The sun is shining, the birds are singing, and you’re my favorite person in the world.
So happy to be spending Spring with you!
Looking forward to many more wonderful memories together this year!
Saying “I do” without having taken the time to capture such a beautiful moment together just doesn’t seem right.
Love always evolves, and so do our photos together – proving that it never really ends.
A new love in the springtime!
Together we’re beautiful and unstoppable!
Endless spring, endless love with you!
Sparkling and happy, just like springtime should be!
Catching moments with you is always so much fun!
A whole new season of love with you by my side!
Seeing the world through new lenses.
Holding each other close in the freshness of springtime.
The beauty of being new again.
Eager to start a new adventure together.
Exploring the world with each step we take.
Taking the time to appreciate all that life has to offer.
Unified by the hope of a brand new spring season ahead.
Love biking with my partner in the fresh spring weather!
Love blooms during spring time!
Snuggling all day long under the apricot trees!
Srolling hand in hand through downtown during springtime!
Trying new things together and enjoying every moment of it during this lovely season!
Out and about in nature together 😉
Celebrating spring together!
So happy to be spending spring with you!
Shared laughs and beautiful moments captured during Springtime!
Happiness is all around when you have a Spring loving partner by your side!
A beautiful day for a romantic photo shoot!
Look at how well they’ve grown together!
The happiest couples are the ones who get to tangle every day.
Heads up! Spring is here!
Two hearts who just can’t get enough of each other!
Spring fever has officially hit us and we’re not going to let it go!
So in love… captured during one magical spring day together!
Our favorite photo moment from this Spring season!

Dog Spring Captions

As the weather warms up, dog owners are finding fun in spending time with their furry friends outdoor. Spring is the time of year when dogs go crazy, running around, playing, and sometimes just standing there and barking at things that don’t make any sense. (LOL)

Whether you’re taking a walk in the park or playing fetch in the backyard, make sure to snap some pics and share them with your friends online. But don’t forget to add equally fun captions to them.

We have gathered below plenty of cute and fun dog spring captions for you to use for your post. Use these to tell the world how much your cute fur babies love spring.

Soaking up the sun with my best friend.
Getting a little excited for spring! $springtimealwaysfeelslikeachange.
All bundled up in my pup’s yard. #unleashthedogs #springbreakwithmypup.
Spring is here and so is our pup! We’re getting fresh starts and loving every minute of it!
Our best buds since puppyhood. #bffs.
Inseparable since day one. Can’t wait to explore all new trails this spring together!
Ready for some fresh air? Our pup is too! #adventuretime.
Playing fetch in the park with my pup is the best! #dogsrule #springtimefun.
Crawling around in the dirt with my best friend ☺️.
Taking a lazy walk in the park with my pup..
Playing fetch together all day long ✌️.
♥️.
Wagging our tails as we nap together on the couch 👼.
Springtime definitely brings out the cuteness in our furry friends!
My pup loves to play fetch, and I love to watch her run around with her ball!
Puppies just love being outside in the sun!
Going on walkies with my pup is always a fun time!8.
Getting lost in nature with my pup is always a blast!
Spending time with my dog is the best way to de-stress!
A day with my pup is always a good day!
With my dog by my side, I feel invincible!
Flowers in the garden and my pup by my side —-> Happy spring!
Spring is finally here! Enjoying walks with my pup.
Warm weather & my pup!
Spring is here & so is my pup to match!
Cuddle time with my furry friend in springtime #lovelovemypup #springtime #sunnydays.
Ready for the season of flowers? My pup is too!
Play hard, relax easy! With my pup by my side.
Floppy ears, wagging tail – dog love in full bloom!
Getting out and exploring with my pup on a sunny morning.
Taking it slow this morning with my pup – just enjoying some lazy time together 😊.
Spending some quality time with my pup today – can’t wait for more spring adventures together!.
Springtime means puppy love!
My little furball is so cute in his new spring clothes!
Life is too short to be grumpy–let’s enjoy the sunshine and each other!
Beauty is in the eye of the beholder, and my pup gets a mixed review sometimes.
Puppy love= unconditional happiness.
Springtime is the time of the year when the flowers start to bloom. And I think my dog agrees!
Cuddling up with my pup in the spring sunshine.
A morning walk with my pup around the block in springtime.
Celebrating our love of springtime together.
Soaking up all the sun in our beautiful backyard during spring break.
Just another day with my furry friend by my side!
Dogging it in the sunshine!
Sticking close to my furry friend during Springtime!
Dog Days of Spring! #blessed.
Ready for some SPRING weather? :D.
A pup needs love just like the flowers do!
Looking at the flowers and dreaming of getting puppy kisses.
So lucky I get to spend every day with my pup! What a joy it is.
Rolling in the fresh spring grass.
My fluffy friend brings joy to every single moment.
Puppy love never fails.
I feel so lucky to be able to share my life with this amazing dog.
No matter what, puppy love always prevails.
Making new furry friends this spring!
Ready for some puppy kisses? 😄.
Soaking up some Springtime vibes with my pup ☀️.
Our furry friend always cheers us up in spring! #muttsmatter #springbreak.
Can’t wait to take more walks and photos with my pup this spring!
Happy Spring, my loyal friend!
I’m thrilled to be starting spring with my furry friend by my side!
Loving life with a mutt by my side – #springtime on fleek.
How is spring treating you?
Standing outside in the sunshine with my furry friend by my side = the best part of waking up in the morning!
Spring is a time to get our pup out and about! #buddylove #woofwoof.
The beginning of spring means new adventures within.

Spring Flowers Captions

The weather is getting nicer, and the days are getting longer, which can only mean one thing: Spring is here! With the weather getting warmer, it’s the perfect time to go outside and take pictures of all the pretty flowers that are blooming. Spring is the season of flowers, and it is one of the best seasons for creating a lovely ambiance in any garden.

Whether you’re a nature enthusiast or just looking for something to brighten up your Instagram feed, these captions will make your spring flowers photos stand out. So go ahead and click some photos of the beautiful blooms of spring.

As the days grow warmer, so do the flowers in our garden.
A weekend in the park with friends is a perfect way to enjoy the vibrant colors of spring.
Time spent outside surrounded by beautiful nature is the best way to experience spring.
Spring is such a happy time – all of the flowers are in bloom and life seems to be just getting started!
In springtime, all of nature is waking up from its long winter sleep and starting over again.
Spring is finally here, and with it comes a bountiful crop of flowers!
These flowers are blooming with joy!
The sun is shining, and the flowers are blooming. It must be spring!
I can’t get enough of spring flowers!
Flower power!
Spring is the season for flowers.
The flowers are blooming, and everything is so pretty!
Colorful flowers bring happiness and new beginnings.
Flowers are the perfect way to celebrate the new season.
Spring has sprung! Time to get out there and enjoy it!
It’s the season of flowers, and I’m never going to let go.
Spring is finally here, and that means flowers, trees, and blooming plants!
Flowers are like people—they have their own personalities.
How beautiful is nature when everything starts blooming again?
If you’re feeling down, look at some flowers. It’ll help.
Flowers are like the sun—they brighten up your day.
All of this sunshine makes me feel so happy.
Warm days, cool breezes.
My happy place is full of sunshine and flowers.
I can’t help but smile when I see these beautiful blossoms.
When skies are blue and days are bright.
Sometimes the simplest things are the most special.
Nature always manages to bring beauty no matter how bad our luck got in the winter.
Blooming plants make me feel happy inside.
Getting outside to enjoy all of this Spring weather.
The warmer weather means plenty of outdoor activities to keep us entertained!
Looking forward to a bright and colorful Spring ahead!
Transitioning from winter to spring is always exciting!
Flowers are blooming – and we’re loving every minute of it!
Colorful flowers bring happiness to my life every day.
One step closer to Spring!
Sunny days just make us happy!
Spring is a time when life starts to awaken and whisper to us in the wind. Listen closely…
Time flies when you’re having fun during the Spring season.
Life is beautiful in all seasons, but spring is especially inspiring – can’t get enough of it!
So happy to be outside enjoying all the colorful spring stuff!
#Springtime gives us hope for a better future!
Nothing says Spring like a field covered in tulips!
SPRING….the best part of life 😍😍😍
Thoroughly enjoying the sunsets everyday ☀️☀️☀️ #springtimevibes
Flowers give me hope that someone out there loves me.
Life is like a flower: it blooms and dies, but its beauty lives on forever.
The flowers are blooming, the bees are buzzing, and everything smells so good!
So many blossoms! So many colors! So many smells! So many things to look at in this world, and it’s all just too much, but I love it anyway because life is good, yeah? Yeahhhhh!!!
When I’m feeling down, I just have to look at some flowers, and I feel like I can do anything.
Life is too short not to appreciate all that is good in the world around us.
A beautiful spring day can make even a rainy situation seem worth it!
A walk in the park with my favorite flowers 🌱💗
Blooms on the brain!
Time to start putting away the winter gear and get into the spring spirit!
Getting in some cardio with my favorite flowers 🌺💪
Taking a break from work to enjoy some flowers 😊🌳
Stretching out with some of my favorite flowers 💫
Just woke up, and there’s already so much beauty outside! #bloomeveryday
A field full of spring flowers is such a beautiful sight.
So excited for all of the tulips, daffodils, hyacinths, and other spring flowers that will come popping up soon 🙂
Springtime is a wonderful time to see all the new flowers popping up everywhere.
Flowers bring happiness and joy into our lives, and they’re always a happy reminder of the fleeting nature of life.4. This beautiful field has me feeling inspired and optimistic about the future.
The past few weeks have been crazy busy, but seeing all these colors in nature has really calmed my nerves.
Blossoms remind us that life is always worth living – even during tough times.
Nature is such an amazing source of inspiration – can you believe how many different types of flowers are out there?
Spring is one of my favorite times of year because it’s such a beautiful transition from winter to summer.
Springtime is the declaration that summer is on its way!
Springing into action!
The colors of nature are so beautiful.
Welcome to spring, the season of rebirth!
A peaceful and bright morning, just like I love it!
Vibrant colors on an amazing day!
Finding color in the world again
Glimpses of Spring in a world of gray.
Springs flowers are everywhere!
The promise of new beginnings.
Out with the old and in with the new!
Can’t wait to see all of the flowers blooming this spring!
A fresh start is always welcome.
A new day means a chance to start over.
Falling in love with all the new flowers blooming!
Can’t get enough of all the pretty flowers.
Bloom wherever you are.
A day in progress: tulips, daffodils, and more tulips.
These pretty flowers bring out the best in me!
The aroma of flowers fills the air.
There’s something so therapeutic about spring flowers.
Spring is finally here, and so are the flowers!
Flowers always remind us to look for beauty in life.
Blossoming spirits always make me happy.
Spring is a time when flowers start to bloom!
Flowers are symbols of beauty and love.
Seeing flowers in the spring season is such a delight!
Spring is the time when nature starts to awaken!
Flowers bring happiness and joy to our lives!
Flowers are a source of inspiration for us!
The colors of spring make me feel so happy!
A world full of color – that’s why I love springtime!
The daffodils are starting to bloom!
Flowers are definitely one of my favorite things about spring.
Awakening to new life – that’s what Spring is all about!
Spring flowers bring happiness everywhere they go!
Lovely blooms in nature always make our day!
Springtime means flowers, flowers, flowers!
Springtime is the best time to get out and enjoy all the beautiful flowers!
Bright, cheerful flowers bring happiness to everyone who see them!
Stunning flowers in bloom – spring is here!
These flowers are perfect for a spring day – their colors are so cheerful!
Blooming petals show us that spring is here to stay!
The freshness of spring flowers fills our hearts with joy!
Sun-drenched flowers in bloom.
Flowers always make everything look so romantic…
Flowers = happiness!
The prettiest flowers are blooming, and we’re so happy to be able to capture them in all their glory!
Bringing beauty and cheer to any environment, flowers are amazing!
Lovely wildflowers decorate the sides of this road in Springtime!
We can’t resist a picture of a field full of tulips in Springtime!
Bright and beautiful flowers in the springtime are a sign of hope and change.
Springtime is a time for renewal and growth, and flowers symbolize both of those things.
Blooms bring happiness, joy, and peace to everyone who sees them.
Roses really do love company 😍 #springbloom
When the sun comes out, the flowers come out too!
Seeing stunning flowers in nature is one of the most beautiful experiences you can have.
Flowering plants are a reminder that beauty always exists in the world around us.
Plants are symbols of life and growth, and they are always a source of inspiration.
Springtime is the perfect time to celebrate all the new life that is emerging in the world.
Flowers represent hope and optimism, which is why they are so popular in the springtime.
Flowering plants are a source of natural beauty and charm.
Seeing the wildflowers in bloom at my local park is one of my favorite things about springtime.
The colors of spring are so bright and cheerful – it’s hard not to feel happy!
When I wake up in the morning, all I see are flowers.
Blooms + sunshine = perfection!
Flowers are symbols of happiness, love, innocence, and joy – things that make life worth living!
I believe in miracles every single day!
Sheer delight! Just look at all the happy little flowers blooming in springtime!
On sunny days like today, nothing beats sitting outside and enjoying the wonderful aroma of wildflowers in bloom.
You don’t have to go far to see stunning displays of beautiful spring flowers – all you need is your backyard!
Tender hyacinths peer through the grasses, their aroma filling the air.
The crocuses are starting to poke through the snow, greeting spring with color.
Soft pink tulips line a street lamppost, welcoming passersby to the season.
The daffodils are coming out in full force, their bulbs reaching up to the sky.
Look at the beautiful flowers blooming in the garden!
A field of daisies welcomes the arrival of springtime.
Blooming petunias add a bright note to any garden.
The flowers are starting to come alive!
Springtime is a time to smell the roses (or tulips, or whatever flowers you like!)
Hyacinths, tulips, and daffodils offer a colorful display for all to enjoy.
Brightly colored lilies fill the air with their unforgettable fragrance.
A meadow full of buttercups is a harbinger of springtime happiness!

Conclusion

That’s our list of captions to help you capture the beauty and bounty of spring. Whether you are a nature lover or just enjoy seeing colors come back into life, these captions will go perfectly with Spring-themed Instagram posts.

Thanks for reading this article. Hopefully, you were able to find some good ones that fit your needs, and if not, hopefully, we were able to help you brainstorm a few good ideas. If you found it useful, please share it on social media for others to read this article.

Wishing you all the warmest spring weather possible!

603 Picnic Captions To Kick Up The Fun At Any Outing

1461 One Word Captions To Spice Up Your Photos and Videos

743 Lake Captions for Beautiful Photos of Lakes

How Does DuckDuckGo Make Money? Business Model of DuckDuckGo

DuckDuckGo is one of the most popular search engines in the world. Unlike other search engines, DuckDuckGo claims it doesn’t make money from tracking and selling users’ personal data.

DuckDuckGo primarily makes money via keyword-based advertising. However, the company also makes money from affiliate partnerships with eBay, Amazon, and Microsoft and from licensing fees for their Tracker Radar Tool.

Founded in 2008 by Gabriel Weinberg, DuckDuckGo is known for being a privacy-focused search engine. DuckDuckGo is currently a private company.

What is DuckDuckGo & How Does It Work?

DuckDuckGo is a search engine provider known for its strict policies around respecting user privacy. Its stance toward user privacy is what sets the company apart from other search engine companies. That has made it, according to some estimates, one of the most popular search engines on mobile devices in the US today. It’s second only to Google.^{^[1]}

Though DuckDuckGo was formed in 2008, it didn’t take off until 2013, when Edward Snowden brought to light the US National Security Agency’s mass surveillance program. That year, the company reported a 600% increase in traffic.^{^[2]} According to founder Gabriel Weinberg, the company became profitable in 2014.^{^[3]}

With a steady stream of data-tracking scandals in recent years, internet privacy is increasingly central in peoples’ minds. DuckDuckGo promises users a search engine that will keep them safe from surveillance.

Normally, when you access a website through a search engine, the search engine uses your IP address to record what you searched for and what site you then accessed. The website you navigate to can likewise record your IP address and the search that brought you there.

DuckDuckGo claims to block this process. They hide your IP address both from the websites you access through DuckDuckGo and from DuckDuckGo itself. This is different from standard search engines. For example, Google records what searches you make and what sites you access from your search.

Moreover, according to DuckDuckGo’s own research, Google has data trackers in 85% of the top 50,000 websites.^{^[4]} These trackers allow them to record what you do within the websites where it has trackers, whether or not you access the website through a Google search.^{^[5]} This gives Google troves of data about you that it sells to ad companies and data brokers.

In DuckDuckGo’s view, Google’s harvesting of personal data makes them less of a search company than an advertising company.^{^[6]} By contrast, DuckDuckGo claims to be a search company that protects you from third-party tracking and records only what data it needs to deliver your search result. These are just the keywords you use to search.

Inspired by the popularity of their search engine, DuckDuckGo introduced other internet privacy tools. Many of these tools are bundled together in their ‘Privacy Essentials’ browser extension, compatible with Chrome, Safari, and Firefox.

The extension makes DuckDuckGo your default browser and blocks 3rd party trackers from loading. It also provides an encryption service that limits search results to encrypted websites. In addition, it gives you email protection that blocks data-tracking when you open an email. Finally, it includes privacy controls that allow you to set your own privacy preferences on sites across the web.

Building on their encryption tool, DuckDuckGo introduced its ‘Tracker Radar Tool.’^{^[7]} This is a continuously updated database of common online data-trackers and a detailed description of their performance profile.

Using the Privacy Essentials extension, individuals and developers can increase their security by blocking all sites that are detected to use these trackers. They can also make customized block lists. It’s so well-respected that researchers use the tool as an accurate, accessible resource about data-tracking.

DuckDuckGo’s commitment to noninvasiveness doesn’t appeal to all users. After all, one benefit of a search engine storing information about your past activity is that, over time, it can learn your idiosyncratic preferences, interests, and political orientation.

This allows it to more accurately predict what you are searching for. It also allows the search engine to present you with content and ads that are more relevant to you. In short, it delivers a personalized search experience.

By contrast, DuckDuckGo is designed to give you a non-personalized experience. It is consequently known for being a ‘no frills’ search engine. That can be off-putting for many accustomed to more traditional search engines.

DuckDuckGo’s algorithms are reportedly less advanced than other top search engines. They also provide fewer protections from viruses and malware.^{^[8]} For the majority of users, these perceived drawbacks are likely to outweigh the benefits of increased privacy.

Despite this, DuckDuckGo has captured a small corner of the market. They average over 100 million search queries a day. The company ranks 5^th in global search behind Google, Baidu, Yahoo, and Yandex.^{^[9]}

Business Model of DuckDuckGo

In 2008 when DuckDuckGo launched, it entered a market dominated by a few key players. Google has since effectually developed a monopoly. Rather than adopting the strategy of becoming the most popular search engine in the world, DuckDuckGo decided to pivot their business model to fill a specific niche.

They chose to market their search engine to a segment of people who are opposed to the prevalence and invasiveness of data-tracking and desire greater online privacy. In exchange for greater online privacy, DuckDuckGo users sacrifice some of the bells and whistles of standard search engines.

Much like Signal, the privacy-focused instant messaging company, DuckDuckGo tries to make that sacrifice a selling point rather than a drawback. In these ways, DuckDuckGo has been able to be candid about its limitations. Users are choosing it for privacy, not for performance.

A clear strength of DuckDuckGo’s business strategy is that it is hard for competitors to replicate its model successfully without giving up potential revenue they need to sustain their business.

Many search engine providers, including Google, are now taking steps to limit users’ exposure to third-party tracking. For example, Google is allegedly phasing out tracking ‘cookies.’^{^[10]} This could prevent some from defecting to DuckDuckGo.

However, it’s doubtful that standard search engine providers will stop tracking users’ data themselves. Data is too central to their business model. It is DuckDuckGo’s commitment to not do this that really sets DuckDuckGo apart from its competition.

In terms of carving a niche for itself, DuckDuckGo’s business model thus seems to be a fairly secure one. However, there are other risks with the business model that DuckDuckGo has adopted.

First, given the data-driven economics of the internet, it’s hard to monetize a site committed to user privacy. Where other search engines make most of their money from targeted ads that are enabled through data-tracking, DuckDuckGo can run only non-targeted, keyword-based ads.

This means that the ads you see on DuckDuckGo are a function only of the terms you used in your last search. The trouble is that compared to targeted ads, non-targeted ads are much less profitable. Though DuckDuckGo says that their non-targeted ads alone are enough to make the company profitable, they are always also looking for other sources of revenue.^{^[11]}

This has led the company to form affiliate partnerships with other companies, including eBay, Amazon, and, more recently, Microsoft. The idea behind these partnerships is that DuckDuckGo automatically receives a commission every time a user of DuckDuckGo accesses one of the affiliate websites and makes a purchase.

However, as DuckDuckGo explains it, the mechanism by which this occurs is anonymous, and no information about the user is shared between DuckDuckGo and the partner website. Through such partnerships, DuckDuckGo supplements the income it receives from non-targeted ads.

However, in May 2022, DuckDuckGo shook the trust of some users through a lack of transparency related to another partnership. As part of a new agreement with Microsoft, DuckDuckGo permitted select Microsoft companies special data-tracking privileges while continuing to block other companies from data-tracking.

This decision was made without informing DuckDuckGo users.^{^[12]} After an initial wave of online backlash, DuckDuckGo amended its contract with Microsoft to remove special tracking privileges.^{^[13]}

If the initial backlash and the recent dip in traffic below 100 million searches a day are any indication, the breach of trust may have been a costly one to the company.^{^[14]} It remains to be seen how they will recover from it.

One risk of DuckDuckGo’s business model is that if they make a single privacy misstep, their entire value proposition may be called into question. While the company’s recent blunder with Microsoft may blow over, it could also generate disappointment and frustration from its user base. Because DuckDuckGo’s brand rests on their staunch commitment to user privacy, getting caught betraying one’s stated commitment is risky.

While demographic to which DuckDuckGo markets itself may be a minority, it is a significant minority. It could also be a growing one. For example, after Roe vs. Wade was overturned in the US, many Americans became more concerned about online privacy.

Law enforcement has a history of turning to Google with subpoenas for personal search information to help with criminal investigations. For that reason, many abortion rights advocates and journalists have been recommending those wishing to research abortion use DuckDuckGo rather than Google or other search engines to do so.^{^[15]}

Every time concerns about government surveillance rise, DuckDuckGo generates more publicity. Use of the search engine could rise in a post-Roe world similarly to how it did after the Snowden revelations.

But that might end up being counter-productive. If government regulations were suddenly to emerge requiring search engine providers to track users’ activity and to share this data with authorities, DuckDuckGo’s value proposition could suddenly evaporate. A company that bases its value entirely on a single feature accepts inherent risks.

How Does DuckDuckGo Make Money?

DuckDuckGo makes money in three ways. Their main revenue streams are non-targeted ads, affiliate-partnerships, and licensing fees for commercial use of its Tracking Radar.

DuckDuckGo does not publicly release its financials, so the relative distribution of revenue across the company’s income streams isn’t clear.

Non-Targeted Ads

DuckDuckGo sells keyword-based ads to advertisers on its platform. Unlike most online ads, there is no way for companies to target them towards people who have visited their site previously or people who are from a particular demographic. For that reason, companies tend to pay less for them.

DuckDuckGo has reported that it makes the majority of its revenue is from advertising. They also report that, as of 2021, they are making at least $100 million of revenue a year.^{^[16]} This is a tiny amount of money in comparison to Google which made $149 billion in 2021 alone just from search advertising.

Licensing Fee for Tracker Radar

DuckDuckGo built a tool that detects trackers hidden on popular websites by ad networks like Google or Facebook. Their Tracker Radar tool logs how these trackers use the browser API, the cookies they set, and any other data they might collect.

Once they know how these trackers work, they create a tracker block list. While they provide the source code for this for free on Github, DuckDuckGo makes money when other companies license their tracker to use commercially.

Affiliate Partnerships

DuckDuckGo has created affiliate partnerships with companies like Amazon, Microsoft, and Ebay. When they send business to those sites and the person buys something, DuckDuckGo receives an affiliate commission.

DuckDuckGo claims that they keep your data private while they facilitate this. It’s unclear how much these companies pay DuckDuckGo for each referred sale. In all likelihood, DuckDuckGo has negotiated different contracts with each of the companies for different percentages. It could also depend on what is bought. Amazon is known for paying different levels of commission on different kinds of products.

It is also unclear how much the company makes in total off affiliate partnerships.

DuckDuckGo Funding, Valuation & Revenue

DuckDuckGo is currently a private company and doesn’t regularly release their financial information publicly.

DuckDuckGo has raised $172 million in venture capital funding during 5 funding rounds. Notable investors include Quiet Capital, Omers Ventures, and Bracket Capital.^{^[17]}

The company last raised capital in late 2021. At the time, it took on investments of $100 million from a pool of new and existing investors. In a blog post that discussed the investment, the company claimed to have been profitable since 2014 and to be generating over $100 million in revenue per year. ^{^[18]}The investment was focused around helping the company grow, creating liquidity for employees and early investors, and improving the company’s financial position.

While information about their revenue growth isn’t public, DuckDuckGo’s search growth has been impressive in recent years.

Year	Annual Searches on DuckDuckGo
2018	9.24 billion
2019	15.05 billion
2020	23.65 billion
2021	35.30 billion

Is DuckDuckGo Profitable?

DuckDuckGo claims they have been profitable since 2014. As of 2021, the company made over $100 million a year in revenue. However, the company took on a new investment of $100 million in late 2020 with a goal to grow their business.

Whether the investments necessary to power that growth will affect their profitability in the future remains to be seen.

Conclusion

Thank you for reading this article on how DuckDuckGo makes money. We hope that this helped you to understand how DuckDuckGo works and why it is different from other search engines.

We are at a turning point in the way companies handle our personal data. The internet has become a place where we all share information, but at times it feels like the companies who run it are more interested in sharing our personal information than they are in protecting it. This creates an environment where many people feel like they have lesser control over their own personal lives.

We are confident that by reading this article, you learned something new about DuckDuckGo, and how they are working to change things for the better.

21 Compliance Training Statistics You Need to Know

39 SEO Spending Statistics To Boost Your Business

Sources

19 Impressive AI in HR Statistics That You Should Know 2026

When you’re trying to get a handle on the latest in AI in HR, there’s no shortage of information out there. But how do you find the right statistics?

You could try digging through dozens of articles and blog posts, but that’s exhausting and time-consuming! Or worse: You could end up with inaccurate or outdated information.

It’s hard to know where to start when you’re looking for relevant and current AI in HR statistics—but it doesn’t have to be this way!

That’s why we have put together the definitive list of AI in HR statistics so that you don’t have to waste hours searching for them. With this list, all you have to do is scroll through our carefully curated collection of stats that will give you the full picture of how AI is being used in HR right now.

Top AI in HR Statistics (Editor’s Picks)

Almost 60% of survey respondents confirmed that their organizations currently use AI for talent management.
44% of people believe that artificial intelligence will free up the recruiter’s time.
Smart AI mechanisms can eliminate 75% of applicants from the recruiting process.
79% of recruiters think that artificial intelligence will soon be advanced enough to hire applicants and fire employees.
Approximately 23% of survey respondents admit they’re scared for their job because they believe AI will replace them.
49% of people claim that AI in recruitment will be the most useful to the IT sector.

General AI in HR Statistics

1. Nearly 82% of HR teams will adopt more AI tools into their talent management processes between 2021 and 2025.

(HR Executive, Eightfold)

According to a 2021 Eightfold AI survey of almost 225 US HR professionals who are primarily manager-level and above, nearly 82% said their teams would adopt more artificial intelligence tools into their management processes in the next five years.

As the chief marketing officer at Eightfold AI, Ligia Zamora, confirms, the changing nature of work requires reliance on technologies like artificial intelligence.

2. Almost 60% of survey participants confirm that their organizations currently use AI for talent management.

(HR Executive, Eightfold)

Many companies find using AI in HR for interviewing highly beneficial. Furthermore, many of them have already incorporated such technologies to support talent management.

As the Eightfold AI survey from 2021 confirms, 60% of survey respondents say that their organizations use AI to personalize the candidate and employee experience. They also use it to match candidates to roles, offer upskilling and reskilling, answer questions via chatbots, and map career paths.

3. 66% of CEOs think AI can drive significant value in human resources.

(IBM, Zoom Info)

There are many reasons why a company should use AI in HR. For instance, artificial intelligence enables recruiters to quickly find qualified candidates, creates engagement in a candidate’s journey, allows more effective onboarding, and improves employee training.

Still, AI can be biased and raise some privacy concerns, so companies should also take that into consideration.

Stats Regarding AI in HR Pros and Cons

4. 44% of people think AI will free up the recruiter’s time.

(Tidio)

Tidio’s extensive research reveals that 41% of HR professionals think AI can provide valuable insights during the recruitment process, while 39% believe it can make a recruiter’s job easier.

Nevertheless, some of them (35%) claim that AI in hiring might lead to overlooking unconventional and unique talents or that it will destroy the HR industry (26%).

5. 68% of recruiters claim that using AI in the recruitment process will take care of the unintentional bias.

(Tidio)

One of the most important benefits of AI in HR is that AI can take care of bias during hiring processes. Tidio’s extensive study points out that nearly 70% of recruiters think using AI during recruitment takes care of the unintentional bias.

Still, AI can be biased, too. For instance, there was a problem with the algorithmic bias at Amazon, when AI was favorable towards men for positions that men got before.

Therefore, it’s of the utmost importance to assist AI or ensure it doesn’t happen.

6. Merely under 14% of recruiters need help with giving feedback to candidates, which is a problem that AI could solve.

(Tidio)

If there’s something job applicants hate, it’s not receiving feedback or not being informed about the outcome of their interview. Still, many hiring managers are too busy to reach out to all applicants, especially if there are many of them for a job position.

Therefore, those who need help from AI in HR recruitment can make their jobs way easier when getting back to all candidates is in question.

7. 45% agree that AI in HR boosts their company’s scalability and drives business impact.

(People Matters, Eightfold)

The Eightfold’s 2021 report highlights the best ways HR leaders use advanced technology to recruit and retain employees.

The AI in HR research papers further reveals that 50% of respondents say that upskilling and reskilling current employees would be the most effective way to impact their company.

8. 90% of people think AI can be manipulated by job applicants.

(Tidio)

Both humans and artificial intelligence can make mistakes. Still, a survey has shown that 46% of people think that AI can be manipulated easily, while only around 9% believe that it’s advanced enough not to be manipulated.

Likewise, 31% of survey respondents claim that job applicants will use AI to manipulate recruiting processes to get jobs, at least to some extent. Moreover, 44% think they certainly will. Only 24% believe they won’t use AI to manipulate recruiting processes.

Statistics About Using AI for HR Recruitment

9. Smart AI mechanisms eliminate 75% of applicants from the recruiting process.

(Better Works)

This statistic can seem worrying to people who apply for jobs. Eliminating 75% of candidates is discouraging, and AI is to blame. Nevertheless, smart artificial intelligence mechanisms can scan, read, and evaluate job applicants much faster.

In addition, artificial intelligence has the potential to expand HR as a resource, as it can make time for HR to focus on improving the employee experience. Apart from that, AI can improve decision-making in hiring.

10. Approximately 7% of job applicants would be offended if they were onboarded by AI.

(Tidio)

Some job applicants would be offended if AI was included in the recruitment process. Luckily, the majority of people (76%) wouldn’t have problems with being onboarded by AI, while 47% would be okay with it, but only partly.

Additionally, 29% would like to be taught about the workplace by artificial intelligence. Also, 18% of people would rather like to meet people during their onboarding process rather than rely on AI.

11. 79% of recruiters think that AI will soon be advanced enough to hire applicants and fire employees.

(Tidio)

AI already aids professionals in making hiring and firing decisions, but some recruiters still think that it’s not advanced enough to independently decide if someone should be hired or hired. Interestingly, only approximately 43% of candidates share the same opinion.

It seems that AI in HR practices are still not accepted by everyone, especially job applicants. For instance, 56% of applicants don’t want artificial intelligence to make decisions related to firing and hiring employees, while only around 22% of recruiters think the same.

12. 75% of people would let AI decide if an applicant should be hired as long as a human being is also involved in the decision.

(Tidio)

It’s safe to assume that the best option (at least for now) is that artificial intelligence should be used by people and not do things on its own.

For example, Tidio’s study suggests that three-fourths of respondents would let AI decide whether an applicant should be hired or not. On the contrary, only around 25% believe that it’s entirely unfair that artificial intelligence making recruitment is allowed to make hiring decisions.

Other AI in HR Trends, Stats, and Facts

13. Approximately 23% of survey respondents say they’re scared for their job because they believe AI will replace them.

(Tidio)

Statistics reveal that at least one in five recruiters is concerned about losing their jobs due to artificial intelligence.

Additionally, only around 15% of hiring professionals claim they’re not scared because they know artificial intelligence will never replace the human side of recruitment.

Excellent recruiters know that looking at a CV isn’t enough to determine an applicant’s ability.

14. Only around 13% of people worry that using artificial intelligence in recruitment is dangerous.

(Tidio)

The number of companies using AI in HR is increasing. Still, 13% of people are sure that there are many detrimental effects of using AI in recruitment.

The same statistics further reveal that using artificial intelligence in recruitment is considered dangerous twice more often by older respondents (40+) than by Gen Z. Only 7% of Gen Zers find AI in recruitment dangerous. In comparison, 15% of people in their forties do.

15. 54% of HR executives claim that artificial intelligence will affect integral roles in the HR organization.

(IBM, Zoom Info)

More than half of HR executives think that AI will lead to some changes in the critical roles in the HR organization.

According to AI in HR statistics from IBM’s extensive report, 50% of HR executives realize that artificial intelligence has the ability to transform the main dimensions of HR.

That means that, apart from influencing employees and job applicants, it has a substantial influence on the HR department.

16. 60% of HR leaders think about using artificial intelligence to promote equity and inclusion among employees.

(People Matters, Eightfold)

Thinking that AI will help HR professionals to promote equity and inclusion seems a bit unbelievable, as artificial intelligence can also be biased and make mistakes.

Still, 60% of HR professionals consider using artificial intelligence to promote equity and inclusion among their employees.

17. Indian AI-powered recruitment company called BarRaiser bags $4.2 million in seed money.

(Tech in Asia)

One of the Indian AI HR companies focused on interviewing and hiring job candidates has managed to raise $4.2 million in a seed funding round organized by 021 Capital and Global Founders Capital.

So far, this company has conducted 30,000 technical interviews for over 250 companies around the world. BarRaiser’s proprietary tech uses over 200 data points to assess candidates according to these interviews.

18. 49% of people claim that AI in recruitment will be the most useful to the IT sector.

(Tidio)

Interestingly, incorporating artificial intelligence in recruiting processes might be more useful in some industries. At least, that’s how 87% of people think. Still, not all agree on which sectors will benefit the most.

For example, roughly 49% of people claim it will be the computer and technology sector. Conversely, only around 7% of respondents think advertising and marketing will benefit the most.

Also, nearly 7% believe it would be most helpful in the finance and economy sector.

19. There are currently over 100 startups creating innovative AI solutions for the HR sector.

(HEC)

The use of artificial intelligence in the human resources sector is growing rapidly. While there are currently 600 startups innovating in HR and digital technology, 100 of them are specifically innovating the use of AI in HR.

The use of AI in HR has a lot of benefits for companies: it can help them identify new opportunities within their workforce, increase productivity by analyzing employees’ performance, and even reduce turnover rates.

These start-ups are using AI to help companies find their dream employees and retain those employees once they’re hired. These innovations will be essential to helping companies keep up with the demands of the modern workforce, which includes millennials who want more flexibility at work, older workers who want to stay employed longer, and people from other countries who want to work remotely.

And though these companies are still relatively small compared to their larger counterparts, they’re poised to make a big impact on how we think about work as they grow into more established companies.

Conclusion

Now that you know all of the statistics and facts about AI in HR, we hope that you’re inspired to start using AI technology and data to help your organization grow.

We know that it can be a difficult journey to embrace new technology, but with so many benefits for both employees and employers, there is no reason not to try it today!

We hope you enjoyed reading this blog post on AI in HR statistics. If you want to learn more statistics about the use of AI in business, check out our other blog posts!

If you have any questions about the content of this post or anything else related to our company and its services, please don’t hesitate to reach out to us. We’re here to help!

Thanks for reading!

171 HR Consulting Business Name Ideas to Get Hired Fast

19 Exit Interview Statistics To Transform Your Company

21 Soft Skills Statistics To Help You Advance Your Career

20 HR Chatbot Statistics To Feel Better About The Future

Sources

How Does OfferUp Make Money? Business Model of OfferUp

OfferUp is a popular online marketplace where people post ads and sell new and used products directly to other users. Unlike some of the company’s competitors, it was designed specifically for mobile.

OfferUp is a consumer-to-consumer (C2C) marketplace where users can buy or sell new or used items to each other. The company makes money via fees paid by sellers, advertising, and selling a software solution to car dealers.

Founded in 2011 in Bellevue, Washington by Nick Huzar and Arean Van Veelan, the online marketplace was conceived as a competitor to Craigslist, the popular online classifieds site.

Huzar originally launched a company called DealSpringer in 2010 where a user could add a photo of a deal they found and share it with anyone close by. However, people used the app to share things they were selling themselves. That led to a shift in the business strategy and the creation of OfferUp.^{^[1]}

What is OfferUp & How Does It Work?

OfferUp is a mobile-based local marketplace that competes with companies like Facebook Marketplace and Craigslist. They launched with a goal of providing a better and safer marketplace app experience.

The mobile-first application makes it faster to post an item for sale. You simply take a photo on your phone and quickly upload a post explaining what you’re selling. Everyone on the app has a profile where people they buy or sell to can rate them. This feature was added in response to issues on other local marketplaces where people were robbed or assaulted when they met up to sell someone something.

With OfferUp, you don’t need to share your personal email, phone number, or social media account with potential buyers or sellers. You can communicate with other users right in the app. Unlike sites like Crasgslist, you can also block sellers and report them if you believe they have violated OfferUp’s terms of service.

OfferUp also recommends that users be verified. This program, called TruYou, requires that users share their phone numbers, a scan of an identification card, and a selfie with the company to confirm that they are who they say they are. People who are verified by this program get a badge added to their profile.

Other users then know that the person they’re meeting up with has been verified as the person they’re claiming to be. In addition, they know that if anything goes wrong when they meet up with them, OfferUp will have that person’s identifying information.

The app’s design is more intuitive and attractive than other marketplace apps. The app has a Pinterest-like photo interface where you can search for products or browse visually. That increases the amount of time people spend browsing products on the site.

OfferUp also suggests community meetup spots to users to reduce the chance of harm when someone meets you at your home. They choose bright spots that are well lit, located in front of or inside a police station or at a supermarket, and clearly marked with signs as an OfferUp meetup spot. The company currently has over 1,000 designated meetup spots in communities across the United States.

OfferUp also offers a service that many local marketplaces don’t offer: the ability to ship an item to a buyer who is not local. In this case, people from outside your area can find the item that you’re selling. They can then make an offer and pay for the item and shipping via the app.

In 2020, OfferUp merged with LetGo, a competitor in the mobile local marketplace space. The joint company merged LetGo’s U.S. business under the OfferUp umbrella and kept the LetGo brand name in countries where OfferUp hadn’t launched in such as Sweden, Brazil, and Italy.^{^[2]}

OfferUp had around 20 million monthly active daily users and 90 million app downloads as of 2021.^{^[3]}

Business Model of OfferUp

OfferUp has a few different revenue streams. Their business model brings together some popular monetization strategies commonly deployed by other types of companies with popular monetization strategies commonly deployed by local marketplaces.

First, OfferUp follows the free online classified business model first created by Craigslist. That involves offering free classified ads to facilitate a C2C local consumer marketplace. This is a freemium model where they give away a service in order to get a critical mass of people using it.

OfferUp monetizes sales that have to be shipped but charges no fees when a seller and buyer meet up and exchange the item in person. As OfferUp also handles the processing and shipping logistics with this option, the company is adding a value-added service by connecting buyers and sellers outside their local communities. In that way, OfferUp’s business model mirrors Ebay’s business model.

Another part of OfferUp’s business strategy is to monetize their customers with advertising. Sellers can buy a promoted listing to ensure their item is listed high up in the search results. This is something that people trying to quickly sell something because they’re moving or people selling high value items are willing to pay for.

This is a similar monetization strategy to Amazon’s promoted products where sellers can similarly get prime search result placement by purchasing ads.

Another way OfferUp monetizes their app is by targeting car dealerships listing new and used cars on their site. They have a Verified Dealer Program that helps auto dealers improve their sales on the site with advertising tools, lead targeting software, and other features.^{^[4]}

Craigslist, an OfferUp competitor also monetizes car dealers but does so by charging for postings from dealers. In contrast, OfferUp offers the dealers valuable tools to help them increase their sales on the platform.

Ultimately, OfferUp has focused their business strategy around being an easier to use and safer alternative to sites like Craigslist. However, that has not fully protected buyers and sellers from being attacked, even with the precautions that the company put in place. For example, in 2020, a teenager was brutally attacked and had his car stolne during an OfferUp meetup to sell a car.^{^[5]}

OfferUp’s main competitors might be Craigslist and Facebook Marketplace. However, the fact that the app facilitates non-local sales makes its business model also similar to Ebay or specialty marketplaces like Poshmark, Depop, Etsy, and Nextdoor.

OfferUp is a private company and does not release their financials. While the company is estimated to have annual revenue of around $89.1 million per year, the company also has considerable expenses.^{^[6]} These include things like staffing, hosting, platform, and development expenses.

Due to the lack of data on OfferUp’s financials, it is unclear how profitable OfferUp’s business model is.

How Does OfferUp Make Money?

OfferUp makes money in four different ways. These include fees from sellers, promoted listings, the company’s Verified Dealer Program, and advertising.

As OfferUp is a private company, details about how much revenue they generate from these different revenue streams aren’t public.

Seller Fees

OfferUp charges sellers fees when they sell something that needs to be shipped. Sellers pay a service fee when shipped items are sold. That fee is either 12.9% of the sale price or a minimum of $1.99. The buyer then pays for the shipping costs after the shipping label is created. Sellers also pay a service fee for shipping items. This fee is a percentage of the item’s full price.

Sellers are given a quote of this rate when they list their item but it isn’t calculated until they accept an offer. Not all items can be shipped. They must be under 20 pounds and fit into one of OfferUp’s predefined box sizes.^{^[7]}

Promoted Listings

OfferUp allows sellers to promote their listings in order to sell their items faster. They estimate that promoted listings get 14 times the views as non-promoted listings every day.^{^[8]} When an item is promoted, it is featured in the top 50 items in a search, browse, or category results. That makes the item easier for buyers to find.

Sellers sign up to promote their item for a set length of time. Most sellers usually choose to promote their item for one to three days. Sellers can also create a Promote Plus listing that allows them to create ongoing promotions and have more options.^{^[9]}

Not all items can be promoted. If the item does not have a Sell Faster button at the bottom of the screen, they will not be able to promote that item via a promoted listing. OfferUp does not say how much a promoted listing costs. This might be because the price ranges depending on the item and location.

Verified Dealer Program

OfferUp offers support for car dealerships on its platform via its Verified Dealer Program. The program is aimed at helping dealerships sell cars faster. Membership gives dealerships a suite of tools that help them generate leads.

It also allows dealerships to list their vehicle inventory automation from their DMS provider, gives them increased visibility through advanced advertising options, streamlines communication with prospects, and alerts them to buyers who are shopping for cars of a similar make or model as the ones the dealer is selling.

The cost to the dealership depends on the size of the dealership.

OfferUp offers local advertising to businesses in OfferUp’s markets. Their ads start at as little as $15 per day and allow companies to target buyers and sellers based on location, keyword, and category.^{^[10]}

It is unclear how much OfferUp makes on third-party advertising.

OfferUp Funding, Valuation & Revenue

OfferUp is currently a private company whose financials are not publicly available. It is also unclear what the company’s valuation currently is.

However, OfferUp had raised $381 million in venture capital funding during 9 funding rounds. Notable investors include Andreessen Horowitz, GGV Capital and Pobts.^{^[11]} The company’s last disclosed valuation was $1.4 billion when it raised money in 2018.^{^[12]} While the company has continued to raise money, it has not disclosed its valuation.

It has also been estimated that OfferUp makes around $89.1 million a year in revenue.^{^[13]} Whether that number is accurate or whether OfferUp makes far more than that isn’t clear.

Is OfferUp Profitable?

OfferUp is likely not yet profitable. The company is still private and does not disclose details of their financials. However, it was estimated that the company makes about $89.1 million a year.^{^[14]}

As OfferUp is still in the midst of expanding their markets and increasing their revenue, it is likely the company is not yet profitable since it is prioritizing growth. In the company’s last funding round in 2020, it raised $120 million to merge with LetGo, one of their direct competitors.

The fact that the company hasn’t raised money since suggests that it is generating enough revenue independently to extend its runway for a while after each funding round. It could also indicate that the company has become profitable, but that cannot be confirmed.

Conclusion

As an online mobile-first C2C marketplace, OfferUp is able to connect buyers and sellers in a much more fluid way than traditional eCommerce platforms.

This helps individual buyers and sellers find each other with ease, and because of the relatively low commission rates (between 10-15%), it also makes this type of marketplace a viable option for small businesses and entrepreneurs.

In addition, OfferUp takes care of the shipping process – all you have to do is make sure your item is available to be sold!

Thank you so much for reading this article about how OfferUp makes money. We hope it was helpful and informative! If you liked what you read, we encourage you to share this with your friends and colleagues.

And if you have any questions, comments, or suggestions, please feel free to reach out!

How Does GOAT Make Money? Business Model of GOAT

How Does Zillow Make Money? Business Model of Zillow

335 Car Dealership Name Ideas to Help You Sell More Cars

Recent Posts

General B2B Customer Retention Statistics

1. Typical B2B customer retention rates range between 76% and 81%

2. Customer acquisition costs for B2B brands have increased 60% in 5 years

3. Only 48% of B2B companies focus on customer retention, compared to 82% focused on customer acquisition

4. Around 50% of B2B companies stay with the same vendor for 5 years

5. Referred B2B customers have a 37% higher retention rate than acquired clients

6. 71% of B2B customers are “psychologically and emotionally” detached from their suppliers

7. 71% of high-grown B2B brands have a clearly-defined strategy for customer experience

How Retention Influences B2B Success

8. The average B2B company generates up to 30% of its revenue from retained customers

9. 65% of B2B companies can successfully upsell to retained customers

10. 80% of a B2B customer purchasing decision is based on buyer experiences

11. High-performing B2B brands are twice as likely to invest in retention and experience strategies

12. Investing in customer experience reduces churn by 10-15% for B2B companies

13. 51% of B2B companies avoid vendors after a poor customer service

B2B Retention and Brand Loyalty Statistics

14. 57% of B2B loyalty programs have been running for less than 2 years

15. 39% of B2B brands offer cashback as a retention strategy

16. SaaS companies average around a 3-5% monthly B2B customer churn

17. 75% of business buyers are now influenced by ethics

B2B Retention and Customer Experience Statistics

18. 85% of B2B buyers value customer experience as much as the features of a product

19. 91% of B2B buyers say a positive service experience makes them more likely to make another purchase in future

20. Lack of speed in interactions reduces B2B retention rates

21. 42% of B2B companies invest in customer experience to improve retention

Conclusion

Sources

What is Rakuten & How Does It Work?

Business Model of Rakuten

How Does Rakuten Make Money?

Affiliate Commissions

Pay-Per-Sale Affiliate Commissions

Pay-Per-Lead Affiliate Commissions

Pay-Per-Click Affiliate Commissions

In-Store Shopping Commissions

Data Monetization

Rakuten Funding, Valuation & Revenue

Is Rakuten Profitable?

Conclusion

Sources

Cute Spring Captions for Instagram

First Day of Spring Captions

Funny Spring Captions

Short Spring Captions

Spring Captions for Couples

Dog Spring Captions

Spring Flowers Captions

What is DuckDuckGo & How Does It Work?

Business Model of DuckDuckGo

How Does DuckDuckGo Make Money?

Non-Targeted Ads

Licensing Fee for Tracker Radar

Affiliate Partnerships

DuckDuckGo Funding, Valuation & Revenue

Is DuckDuckGo Profitable?

Conclusion

Sources

Top AI in HR Statistics (Editor’s Picks)

General AI in HR Statistics

1. Nearly 82% of HR teams will adopt more AI tools into their talent management processes between 2021 and 2025.

2. Almost 60% of survey participants confirm that their organizations currently use AI for talent management.

3. 66% of CEOs think AI can drive significant value in human resources.

Stats Regarding AI in HR Pros and Cons

4. 44% of people think AI will free up the recruiter’s time.

5. 68% of recruiters claim that using AI in the recruitment process will take care of the unintentional bias.

6. Merely under 14% of recruiters need help with giving feedback to candidates, which is a problem that AI could solve.

7. 45% agree that AI in HR boosts their company’s scalability and drives business impact.

8. 90% of people think AI can be manipulated by job applicants.

Statistics About Using AI for HR Recruitment

9. Smart AI mechanisms eliminate 75% of applicants from the recruiting process.

10. Approximately 7% of job applicants would be offended if they were onboarded by AI.

11. 79% of recruiters think that AI will soon be advanced enough to hire applicants and fire employees.

12. 75% of people would let AI decide if an applicant should be hired as long as a human being is also involved in the decision.

Other AI in HR Trends, Stats, and Facts

13. Approximately 23% of survey respondents say they’re scared for their job because they believe AI will replace them.

14. Only around 13% of people worry that using artificial intelligence in recruitment is dangerous.

15. 54% of HR executives claim that artificial intelligence will affect integral roles in the HR organization.

16. 60% of HR leaders think about using artificial intelligence to promote equity and inclusion among employees.

17. Indian AI-powered recruitment company called BarRaiser bags $4.2 million in seed money.